KEGG   Arabidopsis thaliana (thale cress): AT2G22040
Entry
AT2G22040         CDS       T00041                                 
Symbol
LST8-2
Name
(RefSeq) Transducin/WD40 repeat-like superfamily protein
  KO
K08266  target of rapamycin complex subunit LST8
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT2G22040 (LST8-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT2G22040 (LST8-2)
Membrane trafficking [BR:ath04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    AT2G22040 (LST8-2)
   mTORC2 complex
    AT2G22040 (LST8-2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 Nup160 eIF2A VID27 CPSF_A HypF_C
Other DBs
NCBI-GeneID: 816739
NCBI-ProteinID: NP_179795
TAIR: AT2G22040
UniProt: F4IIK6 A0A654F035
LinkDB
Position
2:complement(9374438..9376260)
AA seq 313 aa
MFENKPDDSPVYLATASHDQTIRLWQARTGRCYFSFRYPDLHVNRLELTPEKGKLVAACN
PHIRLFDLRSYNPHIPVRNFVSHTKNVMAVGFQYTGHMMYSGSEDGSVKIWDLRVRECQR
EFRSVSPVNTVVLHPNQTELISGDQNGNIRVWDLRADLCSCELVPEVGTPIRSLTVMWDG
TMVVAANDRGTCYVWRSLCERQTMTEFEPLHKLQAHNSHILKCLLSPGNNRYLATASSDK
TVKIWNLDGFKLEKVLTGHERWVWDCDFSMDGEYLVTASSDTTARLWSMRAGKEEMVYQA
HRKATVCCTLLRD
NT seq 942 nt   +upstreamnt  +downstreamnt
atgtttgaaaacaaaccggatgatagtcccgtgtatctcgcaacagcaagccatgatcaa
accatccgattatggcaagcccgaaccggtcgctgttacttttcctttcgctatcctgat
ttgcatgtgaataggcttgagctaacccctgaaaagggtaaactagtagcagcttgcaat
cctcacatacgactctttgatctcagatcctacaaccctcatatacctgtgaggaatttt
gtatcacacaccaaaaatgttatggcggtaggattccaatatactggacacatgatgtat
tcagggtcagaagatggctctgttaagatctgggacttgagggttcgagaatgccaaagg
gagtttagaagtgtttcaccagttaacacagttgttttacacccaaatcagactgaattg
atatctggagaccaaaacggtaatatacgtgtatgggatctcagagcagatttgtgtagc
tgtgaactggtaccagaagtcggtacacctatacggtctttaacggttatgtgggatggg
acaatggtggttgctgctaacgaccgtggaacatgttatgtatggcgctccttgtgtgaa
agacaaacgatgaccgagtttgagccccttcataagctacaagctcataatagccacatc
cttaaatgtctcctttctcctggaaacaacagatatctagcgaccgcatcatctgataaa
acagtcaaaatatggaaccttgatggtttcaaacttgagaaagttttaacaggtcatgaa
agatgggtatgggactgtgacttctcaatggatggagaatatcttgtaacagcatcatcg
gacaccacggctagattgtggtcgatgcgagcgggaaaagaagagatggtgtaccaagct
catcgcaaagctactgtgtgttgtacactactgcgtgattaa

KEGG   Arabidopsis thaliana (thale cress): AT3G18140
Entry
AT3G18140         CDS       T00041                                 
Symbol
LST8-1
Name
(RefSeq) Transducin/WD40 repeat-like superfamily protein
  KO
K08266  target of rapamycin complex subunit LST8
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G18140 (LST8-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G18140 (LST8-1)
Membrane trafficking [BR:ath04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    AT3G18140 (LST8-1)
   mTORC2 complex
    AT3G18140 (LST8-1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 NBCH_WD40 Ge1_WD40 eIF2A Nucleoporin_N
Other DBs
NCBI-GeneID: 821339
NCBI-ProteinID: NP_188442
TAIR: AT3G18140
UniProt: Q9LV27 A0A178VME6
LinkDB
Position
3:complement(6212585..6214804)
AA seq 305 aa
MSQPSVILATASYDHTIRFWEAETGRCYRTIQYPDSHVNRLEITPDKHYLAAACNPHIRL
FDVNSNSPQPVMTYDSHTNNVMAVGFQCDAKWMYSGSEDGTVKIWDLRAPGCQKEYESVA
AVNTVVLHPNQTELISGDQNGNIRVWDLRANSCSCELVPEVDTAVRSLTVMWDGTMVVAA
NNRGTCYVWRLLRGKQTMTEFEPLHKLQAHNGHILKCLLSPANKYLATASSDKTVKIWNV
DGFKLEKVLTGHQRWVWDCVFSVDGEFLVTASSDMTARLWSMPAGKEVKVYQGHHKATVC
CALHD
NT seq 918 nt   +upstreamnt  +downstreamnt
atgagtcagccttctgtgattcttgctacggctagctatgatcacaccatccgattctgg
gaagccgaaactggtcgctgttaccgtaccattcagtatcctgattcgcatgtaaatagg
cttgagataaccccagataagcattatctagctgcagcttgcaatcctcatattcgactc
tttgatgtcaattccaatagtcctcaacctgtgatgacttacgattcacacaccaacaat
gttatggcagtaggatttcaatgtgatgcaaaatggatgtattcaggatcagaagatggc
acagttaagatctgggacttaagggctccgggttgccaaaaggagtatgaaagtgttgca
gcggttaatacagttgttttacacccaaatcagactgaattgatatctggagaccaaaat
ggaaatatacgtgtatgggatctcagagcaaattcgtgtagctgtgaactggtaccagaa
gttgatacagctgtacggtctttaactgttatgtgggatgggacaatggtagtcgctgct
aacaaccgtggaacatgttatgtatggcgcttgttgcgtggaaaacagacaatgacagag
tttgagccccttcataagctgcaagctcataatggccacatccttaaatgtctcctctct
cctgcaaacaaatatctagcgactgcatcatctgataaaactgtcaaaatatggaacgtc
gatggttttaaactagagaaagttttaacaggacatcaaagatgggtttgggactgcgtc
ttctcagtggatggagaatttcttgtaacagcatcatcggacatgacggctagattgtgg
tcgatgccagcaggcaaagaagtgaaagtgtaccaaggtcatcacaaagccactgtgtgc
tgtgcacttcacgattaa

DBGET integrated database retrieval system