KEGG   Arabidopsis thaliana (thale cress): AT2G23070
Entry
AT2G23070         CDS       T00041                                 
Name
(RefSeq) Protein kinase superfamily protein
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03008  Ribosome biogenesis in eukaryotes
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AT2G23070
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT2G23070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT2G23070
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT2G23070
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT2G23070
Protein kinases [BR:ath01001]
 Serine/threonine kinases: Other
  CK2 family
   AT2G23070
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  90S particles
   Kinase
    AT2G23070
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal ABC1 Choline_kinase eIF3h_C Kdo FUSC
Other DBs
NCBI-GeneID: 816837
NCBI-ProteinID: NP_179889
TAIR: AT2G23070
UniProt: O64816 A0A178VQH1
LinkDB
Position
2:complement(9823642..9826898)
AA seq 432 aa
MALRPCTGFTISSLRNASAANNNLFSLLSFSSSSPAKRNLLLSSLQDNLRRFASSASLYR
QHLRNQQQQHQQQQQSRVKEKSETLAQKIGKSIRRAGAPSKARVYADVNVVRPKDYWDYE
SLAVQWGVQDDYEVVRKVGRGKYSEVFEGIHATDNEKCVIKILKPVKKKKIKREIKILQN
LCGGPNIVKLLDIVRDQQSKTPSLIFEHVNNKDFKVLYPTLSDYDVRYYIFELLKALDFC
HSRGIMHRDVKPHNVMIDHEQRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQ
DYDYSLDLWSLGCMFAGMIFRKEPFFYGHDNYDQLVKIAKVLGTDELNAYLNKYRIELDP
NLTSLVGRHSRKPWTKFINSENQHLAVPEAVDFVDKLLRYDHQERPTAKEAMAHPYFYPI
RNAESSRTPRSQ
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggccttaaggccttgtactggattcacaatctcctctcttcgcaacgcttccgccgcc
aacaacaatctcttctctctcctctccttctcttcgtcgtctccggcgaagaggaatctt
cttctctcttcgctccaggacaatctccgtcgtttcgcatccagcgcttctctttaccgt
caacatctccggaatcaacaacaacaacatcagcaacaacagcaatcgcgcgtgaaagaa
aaatcagaaacgctggctcagaagatcggtaaatctatccggcgtgccggtgcgccgtcg
aaagctagggtttacgctgatgtcaacgttgttagacctaaggactattgggattacgag
tcccttgctgttcaatggggtgtacaggatgattatgaggtggtgaggaaggtaggaagg
ggaaaatacagtgaggtctttgaaggcattcatgctactgataacgagaaatgtgttatc
aagattttgaagcctgtgaagaagaagaagattaagagagagattaagattctgcagaac
ctctgcggtgggcctaatattgtaaaattgctcgacattgttagagatcagcagtctaag
acgcccagcttgatatttgaacatgtgaacaataaagatttcaaagttctctatccaact
ctctcagactatgatgttcgatattacatttttgaacttctaaaggcgttggatttctgc
cattcacgtggaatcatgcacagagatgtgaaaccacataatgtcatgattgatcacgag
cagcgaaaacttcgtttaattgactggggtttggcagaattctatcatcctgggaaagaa
tacaatgtccgtgttgcttcaaggtactttaagggtccagagctgctggtggatttacag
gactatgattattccttagacctatggagtcttgggtgtatgtttgctggaatgatattc
cgcaaggagccgttcttttatggccatgacaactatgatcaattggtcaaaattgcgaag
gtgcttggcacagatgaactcaacgcctacctaaacaaataccgtatagagttggaccct
aatctaacatccctcgtgggcagacatagccggaagccatggacaaagttcatcaattct
gaaaaccagcacttagcagttcctgaggctgttgattttgtggacaagttgctgagatat
gatcaccaagaaaggccaacagctaaagaagcaatggcgcatccatatttctatccgatt
agaaatgcagagagcagccgtacgccgcgcagccagtga

KEGG   Arabidopsis thaliana (thale cress): AT2G23080
Entry
AT2G23080         CDS       T00041                                 
Symbol
CKA3
Name
(RefSeq) Protein kinase superfamily protein
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03008  Ribosome biogenesis in eukaryotes
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AT2G23080 (CKA3)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT2G23080 (CKA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT2G23080 (CKA3)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT2G23080 (CKA3)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT2G23080 (CKA3)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: Other
  CK2 family
   AT2G23080 (CKA3)
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  90S particles
   Kinase
    AT2G23080 (CKA3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal ABC1 DUF5898 Choline_kinase ArgoL2
Other DBs
NCBI-GeneID: 816838
NCBI-ProteinID: NP_179890
TAIR: AT2G23080
UniProt: O64817 A0A178VTA8
LinkDB
Position
2:9827104..9829537
AA seq 333 aa
MSKARVYTDVNVVRPKEYWDYESLVVQWGHQDDYEVVRKVGRGKYSEVFEGKNVNTNERC
VIKILKPVKKKKIKREIKILQNLCGGPNIVKLYDIVRDEHSKTPSLVFEFVNSVDFKVLY
PTLTDYDIRYYIYELLKALDFCHSQGIMHRDVKPHNVMIDHQLRKLRLIDWGLAEFYHPG
KEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKI
AKVLGTNELDHYLNKYQLDLDPQLEALVGRHVPKPWSKFINADNQHLVSPEAIDFLDKLL
QYDHQDRLTAREAMDHPYFAQVKAAESSRLRTQ
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtcgaaagctagggtttatacagatgttaacgttgttcgtcctaaagagtattgggac
tacgagtctctcgttgttcaatggggtcatcaagatgattatgaggttgtgagaaaagtt
ggtagaggaaaatacagtgaagttttcgaaggcaaaaacgtcaatacgaatgagcgttgc
gttatcaagatcctcaaacccgtaaaaaagaagaagataaagagagagatcaaaatactt
cagaacctatgtggtggaccaaatattgttaagctgtatgatattgttagagatgagcac
tccaaaacacctagcttggtatttgagtttgtcaacagtgtggactttaaagtattgtat
ccaacattgactgattacgatatccggtactatatttatgagcttctgaaggcattggat
ttctgtcactctcaaggaataatgcatagggatgttaagcctcataatgtcatgatagat
catcagctgcgtaaacttcgtctgatagattggggccttgctgagttttaccatcccgga
aaagagtataatgttcgcgtggcctcgagatacttcaagggtcccgagcttttagttgat
ctacaggattatgactattctttagacatgtggagtcttggttgcatgtttgctggcatg
atattccgtaaggaaccgttcttttatggccatgataatcatgatcaacttgtcaaaatt
gccaaggtgttgggaaccaatgagttagatcattacctaaacaaatatcagctagatctt
gaccctcaactggaagcacttgttggaagacatgtccccaaaccatggtccaagtttatc
aacgcggacaaccaacatttggtctcacctgaggcaattgattttctcgataagcttctt
cagtatgatcatcaagacagattaaccgcaagagaagccatggatcatccatacttcgct
caagttaaagccgcagagagcagcagactacgaactcagtaa

KEGG   Arabidopsis thaliana (thale cress): AT3G50000
Entry
AT3G50000         CDS       T00041                                 
Symbol
CKA2
Name
(RefSeq) casein kinase II, alpha chain 2
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03008  Ribosome biogenesis in eukaryotes
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AT3G50000 (CKA2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT3G50000 (CKA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT3G50000 (CKA2)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT3G50000 (CKA2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT3G50000 (CKA2)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: Other
  CK2 family
   AT3G50000 (CKA2)
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  90S particles
   Kinase
    AT3G50000 (CKA2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 824162
NCBI-ProteinID: NP_190569
TAIR: AT3G50000
UniProt: Q08466
LinkDB
Position
3:18534450..18537073
AA seq 403 aa
MHLIFFFSYFLRRYLLLLCAILILRAPLAHSLIPPLTCVNTGTVESDVTGIRFDRCLDTD
SLAKISLSTVMSKARVYTDVNVIRPKDYWDYESLNVQWGEQDDYEVVRKVGRGKYSEVFE
GINMNNNEKCIIKILKPVKKKKIRREIKILQNLCGGPNIVKLLDVVRDQHSKTPSLIFEY
VNSTDFKVLYPTLTDYDIRYYIYELLKALDFCHSQGIMHRDVKPHNVMIDHELRKLRLID
WGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYG
HDNQDQLVKIAKVLGTDELNAYLNKYQLELDTQLEALVGRHSRKPWSKFINADNRHLVSP
EAIDYLDKLLRYDHQDRLTAKEAMAHPYFAQVRAAESSRMRTQ
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgcacctaatcttcttcttctcctactttcttcgacggtacctgttgttattgtgcgcc
atcttgatcttacgtgcgccgttggcgcattctcttataccaccattaacgtgcgtcaac
accggaaccgttgaatcagacgttactggtatcaggttcgatcgttgcctcgataccgat
tctctcgccaagatctctctttccaccgtcatgtcgaaagctcgtgtttataccgatgtt
aacgtgatccgacctaaggattattgggattacgaatctctcaatgttcagtggggggag
caagatgattacgaggtagtgaggaaggtggggagagggaaatacagtgaggtttttgag
gggattaacatgaataacaatgagaagtgtattatcaagattctcaagcctgttaagaag
aagaagattagaagggagattaaaatacttcagaatctttgtggagggccaaatattgta
aagctgcttgatgttgtcagagatcaacactcaaaaacgccaagcttgatatttgagtat
gtaaacagcacagactttaaggttctgtatccaacattgactgattatgacattcgctac
tacatctatgagctgttgaaggctttggacttctgccactcacaaggaataatgcacaga
gatgtcaagccacacaatgtcatgatcgaccatgagctgcgcaaacttcgcctaatagat
tggggtctcgctgagttttatcatcctggaaaagagtacaacgtccgtgtggcctcaaga
tacttcaaaggtcccgaacttctagttgatttacaggactatgactattccttggacatg
tggagcctcggttgcatgtttgctgggatgatattccgcaaggaacctttcttctatggc
catgacaaccaggatcagctcgtcaaaattgccaaggtactcggaactgatgaattgaat
gcatatctgaataagtatcagttagaacttgatactcaactagaggcacttgttgggaga
catagcaggaagccttggtccaaattcatcaacgctgacaataggcatttggtctcacct
gaggcgattgattatttggacaagctgctccggtatgatcatcaagacagattaactgca
aaagaagcaatggctcatccctatttcgctcaagtcagggcagcagaaagcagcagaatg
aggactcaatag

KEGG   Arabidopsis thaliana (thale cress): AT5G67380
Entry
AT5G67380         CDS       T00041                                 
Symbol
CKA1
Name
(RefSeq) casein kinase alpha 1
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03008  Ribosome biogenesis in eukaryotes
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AT5G67380 (CKA1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G67380 (CKA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT5G67380 (CKA1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT5G67380 (CKA1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT5G67380 (CKA1)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: Other
  CK2 family
   AT5G67380 (CKA1)
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  90S particles
   Kinase
    AT5G67380 (CKA1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal Choline_kinase ABC1 DUF3858
Other DBs
NCBI-GeneID: 836873
NCBI-ProteinID: NP_201539
TAIR: AT5G67380
UniProt: Q08467
Structure
LinkDB
Position
5:complement(26880966..26884079)
AA seq 409 aa
MIDTLFFLFFLFFDSPLRRLLLLCAVLALRAPTAHSPILRSSIVTPTARAVSEVSGCTTI
DPDFLVEISDSNQTRAMSKARVYTEVNVIRPKDYWDYESLIVQWGEQDDYEVVRKVGRGK
YSEVFEGINVNSKEKCIIKILKPVKKKKIRREIKILQNLCGGPNIVKLLDVVRDQHSKTP
SLIFEYVNSTDFKVLYPTLTDYDIRYYIYELLKALDFCHSQGIMHRDVKPHNVMIDHELR
KLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRK
EPFFYGHDNQDQLVKIAKVLGTDELNAYLNKYQLELDPQLEALVGRHSRKPWSKFINADN
QHLVSPEAIDFLDKLLRYDHQDRLTAKEAMAHAYFAQVRAAETSRMRSQ
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgatagatacgcttttcttcttgttcttcctcttcttcgattctcctcttcgacgtctc
ttgttactgtgcgccgtcttagccttacgtgcgccaacggcgcactctcctatcctacgc
tcatctatcgtcactcccacagcgagagctgtctcggaagtttccggttgtactacgatc
gatccagattttctcgtagagatctctgattctaaccagacgcgggcgatgtcgaaagct
cgtgtgtacaccgaagtcaatgtgattcgacccaaggattattgggattacgagtcactc
attgttcaatggggggagcaagatgattatgaggtagtaaggaaggtagggcgtggaaaa
tatagtgaagttttcgagggtataaatgtgaacagcaaggagaagtgcattatcaaaatc
ctcaaacctgttaagaaaaagaagataagaagagagattaaaatacttcagaacctatgc
ggtgggccaaatattgtcaagctgcttgatgttgttagagatcaacattcgaaaactcca
agcttgatatttgaatatgttaacagcacagactttaaagttttgtatcctacgttgact
gattacgacattcgttactacatctatgagctgttgaaggcactagacttctgccattca
caaggaataatgcacagagacgtcaagcctcataatgttatgattgaccatgagctgcgt
aagcttcgtcttatagattggggtcttgctgagttttaccaccctggaaaagagtataat
gtccgtgttgcctcaagatatttcaagggacctgaacttcttgtggacttgcaagactat
gactattcattggatatgtggagtcttggctgtatgtttgcagggatgatattccgtaag
gaacctttcttctacggccatgacaaccaggatcagctagtgaaaatcgccaaggtgctt
gggactgacgaattgaatgcttatctgaacaagtaccagttagaacttgatccacaactg
gaagcacttgttgggcggcatagcaggaaaccttggtccaaattcatcaacgcagacaat
cagcacttagtttcacccgaggcgattgatttcctcgacaagctacttcggtatgatcat
caagacagattaactgcaaaagaagccatggcgcacgcttacttcgcccaagttagggca
gcagaaaccagcagaatgagaagtcaatga

DBGET integrated database retrieval system