KEGG   Arabidopsis thaliana (thale cress): AT2G30250
Entry
AT2G30250         CDS       T00041                                 

Gene name
WRKY25
Definition
(RefSeq) WRKY DNA-binding protein 25
  KO
K13423  WRKY transcription factor 25
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04016  MAPK signaling pathway - plant
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    AT2G30250 (WRKY25)
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT2G30250 (WRKY25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT2G30250 (WRKY25)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    AT2G30250 (WRKY25)
SSDB
Motif
Pfam: WRKY
Other DBs
NCBI-GeneID: 817575
NCBI-ProteinID: NP_180584
MIPS: AT2G30250.1
TAIR: AT2G30250
UniProt: O22921 A0A654EYX0
LinkDB
Position
2
AA seq 393 aa
MSSTSFTDLLGSSGVDCYEDDEDLRVSGSSFGGYYPERTGSGLPKFKTAQPPPLPISQSS
HNFTFSDYLDSPLLLSSSHSLISPTTGTFPLQGFNGTTNNHSDFPWQLQSQPSNASSALQ
ETYGVQDHEKKQEMIPNEIATQNNNQSFGTERQIKIPAYMVSRNSNDGYGWRKYGQKQVK
KSENPRSYFKCTYPDCVSKKIVETASDGQITEIIYKGGHNHPKPEFTKRPSQSSLPSSVN
GRRLFNPASVVSEPHDQSENSSISFDYSDLEQKSFKSEYGEIDEEEEQPEMKRMKREGED
EGMSIEVSKGVKEPRVVVQTISDIDVLIDGFRWRKYGQKVVKGNTNPRSYYKCTFQGCGV
KKQVERSAADERAVLTTYEGRHNHDIPTALRRS
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgtcttccacttctttcaccgaccttcttggttcttccggcgttgactgttacgaagat
gatgaagacttgagagtttctgggtcgagttttggtgggtactatccagagagaaccggg
tctggtttacctaagttcaagacggctcaaccaccacctcttccgatttcacaatcttct
cataacttcactttctccgattaccttgattctcctctgcttctcagctcctcacacagt
ttgatatctccaacaacaggaacgtttccattgcaaggctttaatggaacaacaaacaat
cactcagattttccctggcagctacaatctcaaccatcaaacgcttcttctgctttgcaa
gaaacatatggtgttcaagatcacgagaagaagcaggagatgattcctaatgagattgca
acacaaaacaacaatcaaagttttggaacagaacgtcagataaagataccagcatacatg
gtgagtaggaactctaatgatggttatggttggagaaaatacggtcagaaacaagtgaag
aagagcgaaaaccctaggagttacttcaagtgtacgtatcctgattgtgtttccaagaag
attgttgagacggcttctgatggacagatcactgagatcatttataaaggtggtcataat
catcctaagcctgagttcaccaagagaccatctcaatcttcattaccatcatcggttaat
gggaggcgcttgtttaatcctgcttctgttgttagtgaacctcatgatcaatcagagaac
tcttcgatttcgtttgactatagtgatcttgagcagaaaagttttaaatcagagtatggt
gagatagatgaagaggaggaacaacctgagatgaagaggatgaaaagagaaggtgaagat
gaagggatgtctatagaagtaagcaaaggagttaaagagccaagagttgtggttcagaca
ataagtgatattgatgttcttatagatggctttagatggaggaaatatggtcaaaaagtt
gtcaaaggaaatactaatccaaggagctactacaagtgcacattccaaggttgtggagtg
aagaagcaagtggaaagatccgcagcagacgagagagcagttctcactacctatgaagga
agacacaatcacgatatcccaaccgcgctacgtcgctcgtga

KEGG   Arabidopsis thaliana (thale cress): AT2G38470
Entry
AT2G38470         CDS       T00041                                 

Gene name
WRKY33
Definition
(RefSeq) WRKY DNA-binding protein 33
  KO
K13424  WRKY transcription factor 33
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04016  MAPK signaling pathway - plant
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    AT2G38470 (WRKY33)
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT2G38470 (WRKY33)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT2G38470 (WRKY33)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    AT2G38470 (WRKY33)
SSDB
Motif
Pfam: WRKY CoiA FLYWCH DUF3439
Other DBs
NCBI-GeneID: 818429
NCBI-ProteinID: NP_181381
MIPS: AT2G38470.1
TAIR: AT2G38470
UniProt: Q8S8P5 B3DNP2 A0A384L4W4
LinkDB
Position
2
AA seq 519 aa
MAASFLTMDNSRTRQNMNGSANWSQQSGRTSTSSLEDLEIPKFRSFAPSSISISPSLVSP
STCFSPSLFLDSPAFVSSSANVLASPTTGALITNVTNQKGINEGDKSNNNNFNLFDFSFH
TQSSGVSAPTTTTTTTTTTTTTNSSIFQSQEQQKKNQSEQWSQTETRPNNQAVSYNGREQ
RKGEDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSLEGQITEIVYKGSHNHP
KPQSTRRSSSSSSTFHSAVYNASLDHNRQASSDQPNSNNSFHQSDSFGMQQEDNTTSDSV
GDDEFEQGSSIVSRDEEDCGSEPEAKRWKGDNETNGGNGGGSKTVREPRIVVQTTSDIDI
LDDGYRWRKYGQKVVKGNPNPRSYYKCTTIGCPVRKHVERASHDMRAVITTYEGKHNHDV
PAARGSGYATNRAPQDSSSVPIRPAAIAGHSNYTTSSQAPYTLQMLHNNNTNTGPFGYAM
NNNNNNSNLQTQQNFVGGGFSRAKEEPNEETSFFDSFMP
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggctgcttcttttcttacaatggacaatagcagaaccagacaaaacatgaatggttct
gctaattggtcacaacaatccggaagaacatctacttcctctttggaagatcttgagata
ccaaagttcagatcttttgctccttcttcaatctctatctctccttctcttgtctctcct
tccacttgtttcagtccctctctttttctcgattcccctgcttttgtctcctcctctgct
aacgttctagcttctccaaccacaggagctttaatcacaaacgtaactaaccagaaaggt
ataaatgaaggagacaagagcaacaacaacaactttaacttattcgatttctcattccac
acacaatcatcaggagtttctgctccgaccacaactacaactacaactacaactacaaca
acaacaaacagttctatctttcaatctcaggaacaacagaagaagaaccagtcagaacaa
tggagccaaaccgagactcgtccaaacaatcaagctgtatcttacaatggaagagagcaa
aggaaaggagaggatggttacaattggagaaagtacggacaaaaacaggtgaaaggaagt
gagaatcctcggagttactataagtgtactttccctaattgtccaacgaagaagaaagtg
gagagatctttggaaggtcagatcacagagattgtgtataaaggaagccacaaccatcct
aaacctcagtctactagaagatcttcttcgtcttcttcgacttttcattcagctgtgtac
aatgccagtttggatcataatcgtcaagcttcttctgatcagcctaattccaataatagc
tttcatcagtctgattcctttgggatgcaacaagaggataatactacttctgattctgtt
ggtgacgatgagttcgaacaaggctcatcgattgtcagcagagacgaagaagattgtggg
agtgaacctgaagcaaagagatggaaaggggacaatgaaacaaatggtgggaatggtggt
ggaagcaagacagtgagagagccgagaatcgtagtgcagacaacgagtgatattgacatt
cttgacgacggttacagatggagaaaatacggccagaaagtcgttaagggaaacccaaat
ccaagaagctactacaagtgcacaaccatcggttgtccagtgaggaaacatgtggagaga
gcatcacacgacatgagagcagtaatcacaacctacgaagggaaacacaaccacgatgtt
cctgcagctcgtggtagcggttacgccacaaacagagcaccacaggattcgtcttcagtc
ccgattagaccagctgctattgctggtcactccaactacactacttcttctcaagcacca
tatacacttcagatgctgcacaacaacaacactaataccgggccttttggttacgccatg
aacaacaataacaacaacagcaaccttcaaacgcaacaaaactttgttggtggtggattc
tctagagcaaaggaagaaccaaacgaggagacctcatttttcgattcgtttatgccctga

DBGET integrated database retrieval system