KEGG   Arabidopsis thaliana (thale cress): AT2G32950
Entry
AT2G32950         CDS       T00041                                 
Symbol
COP1
Name
(RefSeq) Transducin/WD40 repeat-like superfamily protein
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04120  Ubiquitin mediated proteolysis
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AT2G32950 (COP1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT2G32950 (COP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ath04121]
    AT2G32950 (COP1)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     AT2G32950 (COP1)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    AT2G32950 (COP1)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     AT2G32950 (COP1)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 WD40_like zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_5 zf-RING_UBOX U-box zf-C3HC4_4 Prok-RING_4 zf-RING_10 zf-RING_6 YbfN DUF1664 Baculo_p24 zf-rbx1
Other DBs
NCBI-GeneID: 817857
NCBI-ProteinID: NP_180854
TAIR: AT2G32950
UniProt: P43254 A0A178VXE2
Structure
LinkDB
Position
2:13977881..13983609
AA seq 675 aa
MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSEIGAPDLDKDLLCPICMQIIK
DAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTA
SPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVD
ELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFN
SNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARKKRIHA
QFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSRLRVIA
EIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTR
SKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLV
SGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQ
PLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTV
NSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTML
TANSQGTIKVLVLAA
NT seq 2028 nt   +upstreamnt  +downstreamnt
atggaagagatttcgacggatccggttgttccagcggtgaaacctgacccgagaacatct
tcagttggtgaaggtgctaatcgtcatgaaaatgacgacggaggaagcggcggttctgag
attggagcaccggatctggataaagacttgctttgtccgatttgtatgcagattattaaa
gatgctttcctcacggcttgtggtcatagtttctgctatatgtgtatcatcacacatctt
aggaacaagagtgattgtccctgttgtagccaacacctcaccaataatcagctttaccct
aatttcttgctcgataagctattgaagaaaacttcagctcggcatgtgtcaaaaactgca
tcgcccttggatcagtttcgggaagcactacaaaggggttgtgatgtgtcaattaaggag
gttgataatcttctgacacttcttgcggaaaggaagagaaaaatggaacaggaagaagct
gagaggaacatgcagatacttttggactttttgcattgtctaaggaagcaaaaagttgat
gaactaaatgaggtgcaaactgatctccagtatattaaagaagatataaatgccgttgag
agacatagaatagatttataccgagctagggacagatattctgtaaagttgcggatgctc
ggagatgatccaagcacaagaaatgcatggccacatgagaagaaccagattggtttcaac
tccaattctctcagcataagaggaggaaattttgtaggcaattatcaaaacaaaaaggta
gaggggaaggcacaaggaagctctcatgggctaccaaagaaggatgcgctgagtgggtca
gattcgcaaagtttgaatcagtcaactgtctcaatggctagaaagaaacggattcatgct
cagttcaatgatttacaagaatgttacctccaaaagcggcgtcagttggcagaccaacca
aatagtaaacaagaaaatgataagagtgtagtacggagggaaggctatagcaacggcctt
gcagattttcaatctgtgttgactaccttcactcgctacagtcgtctaagagttatagca
gaaatccggcatggggatatatttcattcagccaacattgtatcaagcatagagtttgat
cgtgatgatgagctgtttgccactgctggtgtttctagatgtataaaggtttttgacttc
tcttcggttgtaaatgaaccagcagatatgcagtgtccgattgtggagatgtcaactcgg
tctaaacttagttgcttgagttggaataagcatgaaaaaaatcacatagcaagcagtgat
tatgaaggaatagtaacagtgtgggatgtaactactaggcagagtcttatggagtatgaa
gagcacgaaaaacgtgcctggagtgttgacttttcacgaacagaaccatcaatgcttgta
tctggtagtgacgactgcaaggttaaagtttggtgcacgaggcaggaagcaagtgtgatt
aatattgatatgaaagcaaacatatgttgtgtcaagtacaatcctggctcaagcaactac
attgcggtcggatcagctgatcatcacatccattattacgatctaagaaacataagccaa
ccacttcatgtcttcagtggacacaagaaagcagtttcctatgttaaatttttgtccaac
aacgagctcgcttctgcgtccacagatagcacactacgcttatgggatgtcaaagacaac
ttgccagttcgaacattcagaggacatactaacgagaagaactttgtgggtctcacagtg
aacagcgagtatctcgcctgtggaagcgagacaaacgaagtatatgtatatcacaaggaa
atcacgagacccgtgacatcgcacagatttggatcgccagacatggacgatgcagaggaa
gaggcaggttcctactttattagtgcggtttgctggaagagtgatagtcccacgatgttg
actgcgaatagtcaaggaaccatcaaagttctggtactcgctgcgtga

KEGG   Arabidopsis thaliana (thale cress): AT5G23730
Entry
AT5G23730         CDS       T00041                                 
Symbol
RUP2
Name
(RefSeq) Transducin/WD40 repeat-like superfamily protein
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04120  Ubiquitin mediated proteolysis
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AT5G23730 (RUP2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G23730 (RUP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ath04121]
    AT5G23730 (RUP2)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     AT5G23730 (RUP2)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    AT5G23730 (RUP2)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     AT5G23730 (RUP2)
SSDB
Motif
Pfam: WD40 DUF3215 WD40_like
Other DBs
NCBI-GeneID: 832438
NCBI-ProteinID: NP_568435
TAIR: AT5G23730
UniProt: Q9FFA7
LinkDB
Position
5:8005097..8006630
AA seq 368 aa
MNTLHPHKQQQEQAQQQEEARYEWDLSLSTVVSSSSSSASDVIGAIEFDPTDNIVATAGI
SRKIRFYGLPSLLRNNAVSGTGVSFVDQATACEYYICTPAKLSSLRWRPGSGGRVIGSGD
YDGVVMEYDLEKRTPVFERDEHGGRRVWSVDYTRHGGASTVGASGSDDGTMQVWDPRCPP
EESVGVVRPAGICRSAVCCVEFDPSGGPAVAVGCADRKGYVYDIRKLVDPALTLQGHTKT
VSYVRFLDGGTVVTAGTDGCLKLWSVEDGRVIRTYEGHVNNRNFVGLSVWRNGALFGCGS
ENNRVFVYDRRWGKPVWVDGFEPVGMNSGSDKRFVSSVCWRQSGVDQCTLVAGGSDGVLQ
VYVGKRKP
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaacactcttcatcctcacaagcagcaacaagaacaagcacaacaacaagaagaagct
agatacgaatgggatctttctctctccaccgtcgtatcttcctcctcctcctccgcctcc
gacgttatcggagctattgaattcgatcccactgataacatcgtcgctaccgccgggatt
tcaagaaagattcgtttttacggcctcccttctcttttacgtaacaacgctgtctccggt
accggagtttccttcgtcgatcaagccaccgcctgcgaatattacatctgtactccggcg
aaacttagtagtctccggtggagacccgggtcgggcggtcgggttattgggtcgggagat
tacgacggcgtagtgatggagtacgatcttgagaagaggacgccggtattcgaaagggac
gagcacggtggtcgtcgtgtatggagcgtagattacactcgtcacggcggcgcttcgacg
gtgggcgcgtcgggatcggatgacgggactatgcaagtatgggatccgaggtgtccgccg
gaagaatctgtcggtgttgtacgaccggcggggatttgccggagtgctgtttgttgcgtc
gagttcgatccttccggtggaccagccgtggccgtcggatgcgctgatcggaaagggtac
gtttacgatataaggaaactcgttgacccggcgttgactttacaaggtcatacgaaaacg
gtgtcgtatgtgaggttcctcgacggtgggacggtggtgacggcaggtacggacggttgt
ttgaagctgtggagcgtggaggatgggcgcgtgattcgcacgtacgaagggcatgtgaat
aatcggaacttcgtggggttatctgtgtggagaaacggcgcgttgtttggttgtggatcg
gaaaacaacagggtgtttgtgtacgataggagatgggggaagccggtttgggtagatggg
tttgaaccagttggtatgaattctggttcggataagcggttcgtgagtagcgtctgttgg
aggcaatcaggtgtggaccagtgtaccctagtggctggaggatctgatggagtattacag
gtttacgtgggcaaaagaaaaccatag

KEGG   Arabidopsis thaliana (thale cress): AT5G52250
Entry
AT5G52250         CDS       T00041                                 
Symbol
RUP1
Name
(RefSeq) Transducin/WD40 repeat-like superfamily protein
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04120  Ubiquitin mediated proteolysis
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AT5G52250 (RUP1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G52250 (RUP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ath04121]
    AT5G52250 (RUP1)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     AT5G52250 (RUP1)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    AT5G52250 (RUP1)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     AT5G52250 (RUP1)
SSDB
Motif
Pfam: WD40 WD40_like ANAPC4_WD40
Other DBs
NCBI-GeneID: 835301
NCBI-ProteinID: NP_200038
TAIR: AT5G52250
UniProt: Q9LTJ6
LinkDB
Position
5:21216772..21218351
AA seq 385 aa
MEALFCSEIPNNNIRSSINDLSSSSSYTWPMIMTSSSSSSSSPTIMNIENIPRCDWDLSL
SAVVSSASTGSDAIGAIEFDPTGEIIATGGIARKIRSYRLSSLLESRDDHVTASESYICT
PAKLSSLKWRPDFSGRVIGSGDYDGVVTEYDVEKQVPVSERDEHGGRRIWSVDYTLYNGS
LIGASGSDDGTVQMWDPRNGGTLEETVRPGGGAAICSVEFDPFGGSSIAVGCADRNAYVY
DIRRLVDPLIVLDGHTKTVTYARFMDSHTIVTGSTDGSLKQWDIDNGRRVVRTYRGHVNS
RNFVGLSVWRHGGLVVSGSENNQVFVYDKRWEEPVWVCGLGHTNRFGSDRRFVSSVCLRQ
VDEDWCTLVAGGSDGALEIFSGKQS
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggaggctttgttctgctctgagatacccaacaacaacatcagatcttccattaacgat
ctatcttcttcttcttcatatacatggccaatgatcatgacctcctcttcttcttcttct
tcatctcccacaatcatgaacatagagaacattcctagatgcgactgggatctctctctt
tccgccgttgtttcctccgcatccaccggatcagacgctatcggagcaatcgagttcgac
cctaccggagagatcatagctacgggaggaatcgcaagaaagatcagatcgtatcgttta
agctctttgttagagtcacgtgacgatcacgtaacagcttcagagagctatatttgcacg
ccggcgaagcttagtagtctcaaatggagacccgatttttccggtcgggttatcgggtca
ggagattacgacggagttgtcaccgagtacgacgtggagaaacaagtgcctgtttccgag
agagacgagcatggaggtagaaggatttggagcgtggactacacgctttacaatggctct
cttataggcgcgtcaggctccgacgacggaacggttcaaatgtgggatccacgtaacgga
gggacgttagaagaaacggttaggcccggtggtggagcggcgatttgttcggtagagttc
gatccgttcggtggatcttccatagccgttggatgtgctgaccggaatgcctacgtgtat
gacatcagaagactagtggaccctttgatcgtattagacggccataccaaaacggtgacg
tatgctcgattcatggattctcacacgatcgttaccggttcgaccgacgggagcttgaag
caatgggatatagataatggacggcgcgtggttcgcacgtaccgagggcatgtgaatagc
cggaactttgttgggttgtcggtttggagacatggtggtttggtcgtgtccgggtcagag
aataaccaagtgtttgtgtacgataagaggtgggaggaaccggtttgggtttgtggattg
ggtcatacgaaccggtttggatctgaccgacggtttgttagtagtgtgtgtttgagacaa
gtggatgaagattggtgcacacttgtggccggaggatccgatggggctttagaaattttc
tcgggcaaacaaagctaa

DBGET integrated database retrieval system