KEGG   Arabidopsis thaliana (thale cress): AT2G37840
Entry
AT2G37840         CDS       T00041                                 
Name
(RefSeq) Protein kinase superfamily protein
  KO
K08269  serine/threonine-protein kinase ULK2 [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT2G37840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT2G37840
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT2G37840
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT2G37840
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT2G37840
Protein kinases [BR:ath01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   AT2G37840
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg1 complex
    AT2G37840
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    AT2G37840
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kdo YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 818361
NCBI-ProteinID: NP_850285
TAIR: AT2G37840
UniProt: F4IRW0 A0A5S9X528
LinkDB
Position
2:15851726..15856334
AA seq 733 aa
MAQFTGRVVGDYLVGRQIGSGSFSVVWEARHRVDGTEVAIKEIAMDRLNKKLQESLMSEI
FILRRINHPNIIRLIDMIKSPGKVHLVLEYCKGGDLSVYVQRHGIVPEATAKHFMQQLAA
GLQVLRDNNIIHRDLKPQNLLLSTNENDADLKIADFGFARSLQPRGLAETLCGSPLYMAP
EIMQLQKYDAKADLWSVGAILFQLVTGRTPFTGNSQIQLLQNIIRSTELHFPGDCRDLSL
DCIDLCQKLLRRNPVERLTFEEFFNHPFLSDRQSYDFSRSRLGLRTMDGFLSSGSSPSRN
MEESSQEDCLPFLLDDDSSGPEGSPSYLKKTSSMKSSSGIKVDTRIERKEVESSPLKHTE
LTSGYSSFNQKVENDRFRFETQINSDRRNRREPTGLTDSRSLIAPGRVDDSQDSMDQDFV
LVSGPPVDMPSSSSSSSKPYNFPFKSQSPPVELFNRSISSTAPMPIIGATSNSIGQFGSL
DSQYSAPSTSHGSLDLGDAFEQPSTHSLTRIRSLRKYAATIAELVYERIESDKHLEAFSI
QLAILAIWKQALHICHTQAISGLEGSPSQDINKLRSSSLKHDTHSSNKVTDLSHDGSEEI
SSQIQRQFIQEIELAEELAKSIEPGNTKMPDAMETIFEAALDLGKLGGVKEVMGDTENAG
NQYSKAVRLLVFLLVEAPMLILNPPLSLTNSVRYRLRTYIDFLSRRLKHLQSHRRSSAGQ
MQGSSLAMMNRQS
NT seq 2202 nt   +upstreamnt  +downstreamnt
atggctcagttcacgggtcgggtcgttggagactacttggtgggtcgtcaaatcgggtcg
ggttcgttctctgttgtttgggaagcgaggcaccgcgttgacggtactgaggttgctatc
aaagagatcgccatggacaggcttaacaagaagctgcaggaaagtctcatgtctgagatt
tttatcttgaggaggatcaatcatcctaacatcatccgtctgatcgacatgatcaagtct
cctgggaaagtacatttggtgttggagtactgcaaaggaggtgacttgtctgtgtatgtc
caaagacatgggattgtccctgaagctactgctaagcatttcatgcagcagttagcggcc
ggcttacaagttcttcgtgacaataatattattcaccgagatttaaagcctcagaatctt
cttctatccacaaatgaaaatgatgcagatctgaagattgctgattttggatttgcaaga
tcgttgcaacctagggggctcgcagagactttatgtggttcaccattgtatatggcccca
gagatcatgcaactccagaagtatgatgcaaaggcagatctctggagtgttggtgctatt
ttatttcaacttgtgacaggcagaaccccttttacaggaaacagccaaattcagttgctc
caaaacattataagatcaaccgaattacattttccaggggactgtagagatttaagcttg
gactgcatagacctgtgtcagaagttactgcgccgtaatccagtggaacgtttgacattt
gaagagttctttaatcaccctttcctttcggacaggcagtcatatgatttctccaggagt
agattggggttaagaacaatggacggttttctttcgtctggaagcagtccctcgagaaac
atggaagaaagttctcaagaagactgtttgccgttccttctagatgatgattctagtgga
cctgaggggagcccttcatatttaaaaaagacatcctcaatgaagtcgtcctctggaatt
aaagtcgatacgagaattgagaggaaggaggtggaatctagtcctttaaaacatacagaa
cttacttctggatatagtagtttcaaccaaaaagtggaaaacgatagatttagatttgaa
actcaaataaattcagataggagaaaccgcagggaaccgacaggattgactgattctaga
tcacttattgctccaggaagagtagatgattctcaagactccatggatcaagacttcgtt
ctcgtatctggaccaccagtagatatgccatcatcttcatcaagttcttcgaagccttat
aattttccattcaagtctcagtctcctcctgtagagttattcaacagaagcataagttca
acggctcccatgccaataattggtgctactagcaacagcattggtcagtttgggagcctt
gacagtcagtattctgccccgagcacttctcatgggtctctggatcttggtgatgctttt
gaacagccatcaactcacagcctgacaagaatcaggtctctgagaaaatatgcagcaaca
attgcagaactagtttatgaaaggattgaatctgacaaacatctagaagctttctcgatc
caattggcgattctggcaatttggaaacaggcactgcacatatgtcatactcaggcaatt
tcaggtttggaaggaagcccaagccaagacattaacaaactaagaagtagcagcctgaaa
cacgatactcacagttctaataaagtcactgatctcagccatgatggatcggaggagata
tcctctcagattcagaggcaatttatacaggagattgagcttgctgaagaacttgccaag
agtattgaacctggaaatacaaaaatgccagatgcaatggagacgatatttgaagcagca
cttgatcttggaaaacttggaggagttaaggaggttatgggagatacagagaacgccgga
aaccaatattcgaaagcagtgcgtttgctggtattccttttagtagaagcaccaatgctg
attctgaatccgccactgtctctcacaaactcagtcaggtatcgtctcaggacatatatt
gatttcctcagcagaagattaaaacatctgcagtcacatagaagaagttcagctggtcag
atgcaaggatcatcgttagctatgatgaacagacaatcataa

KEGG   Arabidopsis thaliana (thale cress): AT3G53930
Entry
AT3G53930         CDS       T00041                                 
Name
(RefSeq) Protein kinase superfamily protein
  KO
K08269  serine/threonine-protein kinase ULK2 [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G53930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT3G53930
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G53930
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G53930
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT3G53930
Protein kinases [BR:ath01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   AT3G53930
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg1 complex
    AT3G53930
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    AT3G53930
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kdo YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 824560
NCBI-ProteinID: NP_190961
TAIR: AT3G53930
UniProt: F4JBP3 A0A178VDC3
LinkDB
Position
3:19966149..19970880
AA seq 711 aa
MAQSSLVAAAGRSGRVIGDYAVGRQIGSGSFSVVWEGRHLVHGTVVAIKEIAMARLNKKL
QESLMSEIIILRKINHPNIIRFIDMIEAPGKINLVLEYCKGGDLSMYIHKHGSVPEATAK
HFMLQLAAGLQVLRDNNIIHRDLKPQNLLLSTDDNDAALKIADFGFARSLQPRGLAETLC
GSPLYMAPEIMQLQKYDAKADLWSVGAILFQLVTGRTPFTGNSQIQLLQNIIRSTELHFP
ADCRDLSTDCKDLCQKLLRRNPVERLTFEEFFHHPFLSDKQSYDFTRSRLDSRTMNDFHS
SGSSPSRNIEEISQEDGLPFFLDDDSSGPEGSPSSFKHTSPMKSSYGFSVERREAALSPL
KNMDLSSRYSRVSHRAETNNFKFEGHRLSDRSQFKPSSLPDSRSFSTQGRGDSPDSMDQD
YVLISGPPVDIPSSSSGSPKPFNYPFKSHSPPVEFIKRNVTNLTAPMPIASATGNNLSRF
GSLESQNCIPGTSHGSLDLVDAFEQPSTNSLTRIRSLQKCAAAIAELVHERGENGKHLEA
FSIQLVILAIWNQALHICHTQAVSGIEGSLLQDINRVGRNISHGGSEKLLPQIQKEFVQE
VERAEELAKFVESDNAKMPDAMEMILQAALALGISGGVDEVMGDAENAGNLYSKAVRLLV
FLAVEAQTLILNPPLTLTNSVRYRLRTYIDSLITRLKHLQSHRRTSYPQKQ
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggctcagtcgtcgttggtggcggcggcggggagaagcggaagggttatcggcgattat
gcggtgggtcgacaaatcgggtcggggtcgttttccgtggtttgggaagggaggcatctt
gttcatggcaccgtcgttgctatcaaggagatcgctatggctcggcttaataagaagttg
caagagagtctcatgtcggagattatcatcttaaggaagattaatcatcctaacatcatt
cgctttatcgacatgatcgaggctcccgggaagataaatttggtgttggagtactgtaaa
ggtggtgatctgtctatgtatattcacaaacatggaagtgttcctgaagctactgctaag
cattttatgctgcagttagcggctggcttacaagttcttcgtgacaataatatcattcac
cgcgatttaaagcctcagaatcttcttctatccacagatgataatgatgcagctctgaag
attgccgattttggatttgcaagatcgttgcagcctaggggtttggcagaaactttatgt
ggttcaccactgtatatggccccagagattatgcagcttcaaaaatatgatgcaaaggca
gatctctggagtgttggtgctatattatttcaacttgtgacaggcagaaccccttttaca
ggaaacagccaaattcagttgctccagaacattataagatcaactgaattacattttcca
gcagactgtagagatttgagtaccgactgtaaagatctatgccagaagctactgcgtcgt
aatccagtggaacgtttgacgtttgaagagttttttcatcatcctttcctttcagacaaa
caatcatatgatttcacaaggagtagattagattcacgaactatgaacgattttcattca
tcaggaagcagtccctcaagaaatatagaagaaatttctcaagaagacgggttgccgttc
tttttagatgatgattctagtggacctgagggaagcccttcatcttttaaacatacttcc
ccgatgaagtcatcttacggatttagtgttgaaagaagggaggcagcattaagtcctttg
aaaaacatggatctttcttccagatatagtagagtcagtcatagagcagaaaccaataat
ttcaagtttgagggccatagattatcagatagaagccaattcaaaccgtcaagcttacct
gattccagatcatttagtacccaaggaagaggggattctccagactcaatggatcaagat
tatgttctgatatctggaccaccggttgatataccatcatcttcatctggttctccgaag
cctttcaattacccattcaaatcacattctcctcctgtagagttcatcaagagaaatgta
actaatttaacggctcctatgccaatagctagtgctactggcaacaaccttagtcgattt
ggaagcttggagagtcagaattgtatcccgggtacttcccatgggtctctggatcttgta
gatgcttttgaacagccatcaactaacagcttgacaagaatccggtctttgcaaaagtgt
gcagctgcaatagcagaattggttcatgaaaggggtgaaaatggtaagcatttagaagct
ttctcgatccaactggtgattcttgcaatttggaatcaagcactacacatctgtcatact
caggcagtctcgggtatagaaggaagcctgctccaagacattaacagagtaggaagaaat
atcagccacggaggatcagagaagttattgcctcagattcagaaagaatttgtccaggaa
gtggagcgtgctgaagaacttgccaagtttgttgaatctgataatgcaaagatgccggat
gcaatggagatgatacttcaagcagctcttgctcttggcataagtggaggagtagatgaa
gtgatgggagacgcagagaacgcaggaaacctctactcaaaagcggtgcgtttgttagtc
ttccttgcagtggaggcgcagacgctgattctcaatccacctttaacactcacaaactca
gtaaggtatcgactcagaacatatattgactcactcataaccagattgaaacatctgcaa
tcacatagaagaacttcatatcctcagaagcaatga

DBGET integrated database retrieval system