KEGG   Arabidopsis thaliana (thale cress): AT2G43790
Entry
AT2G43790         CDS       T00041                                 

Gene name
MPK6
Definition
(RefSeq) MAP kinase 6
  KO
K14512  mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04016  MAPK signaling pathway - plant
ath04075  Plant hormone signal transduction
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    AT2G43790 (MPK6)
   04075 Plant hormone signal transduction
    AT2G43790 (MPK6)
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT2G43790 (MPK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT2G43790 (MPK6)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AT2G43790 (MPK6)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   AT2G43790 (MPK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Haspin_kinase Kinase-like FTA2
Other DBs
NCBI-GeneID: 818982
NCBI-ProteinID: NP_181907
MIPS: AT2G43790.1
TAIR: AT2G43790
UniProt: Q39026 A0A178VTX8
LinkDB
Structure
PDB: 
6DTL 5CI6

Position
2
AA seq 395 aa
MDGGSGQPAADTEMTEAPGGFPAAAPSPQMPGIENIPATLSHGGRFIQYNIFGNIFEVTA
KYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHE
NIVAIRDIIPPPLRNAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYI
HSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSD
YTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIR
QLPPYPRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPEC
TIPFNFDFENHALSEEQMKELIYREALAFNPEYQQ
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggacggtggttcaggtcaaccggcggctgatacagagatgacagaagctcctggaggt
tttcccgcggcggctccatcgcctcagatgcctgggattgagaatattccggcgactctt
agccatggtggtaggtttattcagtataacatatttggaaacatcttcgaggtcaccgct
aagtataagcctccgatcatgcctattggcaagggtgcttatggcatcgtttgttcggct
atgaattctgaaactaacgagagcgttgcgattaagaaaattgctaacgcttttgacaat
aagattgatgctaagaggactctccgtgagatcaagctgcttcgtcacatggatcatgaa
aatattgttgcaatcagagatattatcccgccaccattaagaaacgctttcaacgatgtt
tacatcgcgtatgagttaatggacactgatctccatcaaatcattcggtcaaatcaagca
ttatccgaagaacattgccagtattttctttaccagatcctccgtggattgaaatacatt
cactctgcaaatgtgcttcacagggatttgaaaccaagtaatctcctcctgaacgcaaac
tgcgacctaaaaatctgcgattttgggctagctcgagtcacttctgagagtgatttcatg
actgaatatgttgtcacgagatggtaccgtgcaccagagcttctcttaaactcttctgat
tatactgcagctatcgatgtttggtctgtaggctgtattttcatggagttaatggaccgt
aagccactcttccctggacgagatcatgtccatcagcttcgcttgctcatggagctcata
ggaactccatcagaagaagagctcgagttcttgaacgaaaacgcaaagcgatacataaga
cagcttccaccttatcctcgccaatccatcactgataagttcccgacagtgcatccttta
gctatagaccttatcgagaagatgttaacatttgatcctagacggagaatcacagtttta
gacgcattggcccatccatacctgaactcgttgcacgacataagcgatgagccagagtgt
acaatacctttcaactttgattttgaaaaccatgcactctcagaggagcagatgaaggaa
ctaatctaccgcgaggcgcttgctttcaatccagaatatcagcaatag

KEGG   Arabidopsis thaliana (thale cress): AT3G45640
Entry
AT3G45640         CDS       T00041                                 

Gene name
MPK3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K20536  mitogen-activated protein kinase 3 [EC:2.7.11.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04016  MAPK signaling pathway - plant
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    AT3G45640 (MPK3)
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT3G45640 (MPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT3G45640 (MPK3)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AT3G45640 (MPK3)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   AT3G45640 (MPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like FTA2 Haspin_kinase APH
Other DBs
NCBI-GeneID: 823706
NCBI-ProteinID: NP_190150
MIPS: AT3G45640.1
TAIR: AT3G45640
UniProt: Q39023 A0A384L050 Q0WVS7
LinkDB
Position
3
AA seq 370 aa
MNTGGGQYTDFPAVETHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDTET
NELVAMKKIANAFDNHMDAKRTLREIKLLRHLDHENIIAIRDVVPPPLRRQFSDVYISTE
LMDTDLHQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANIIHRDLKPSNLLLNANCDLKI
CDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPLFP
GKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPMAIDL
VDRMLTFDPNRRITVEQALNHQYLAKLHDPNDEPICQKPFSFEFEQQPLDEEQIKEMIYQ
EAIALNPTYG
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaacaccggcggtggccaatacacggattttccggcggtggaaactcacggaggacag
ttcataagttacgatatcttcggtagtttattcgagatcacatctaagtatcgtcctccg
attataccaattggtcgtggagcttatggaatcgtttgctctgtgttggatacggagacg
aacgagctagtagcgatgaagaagatagctaatgcttttgataatcatatggatgctaag
cgtacgcttcgtgagatcaagcttcttcgtcatcttgatcatgaaaacattatagctata
agagatgttgttccaccaccactaagaagacagttcagtgatgtttatatctctactgaa
ttaatggatactgatcttcatcaaatcatcagatctaaccagagtttatcagaagaacac
tgtcagtacttcttgtaccagctacttcgaggactgaagtatatccactcagctaacatt
attcatagggatttaaagccgagcaatcttctgttgaacgcgaattgcgatttaaagatt
tgtgatttcggtcttgctagacctacttcagagaatgattttatgactgagtatgttgtt
acgagatggtatagagcacctgagcttctgttgaactcttcagattacacagctgctatt
gatgtttggtctgttggttgtatctttatggagcttatgaatagaaagcctttgttccct
ggtaaagaccatgttcatcaaatgcgcttattgacagagttgcttggcacaccgacagaa
tctgatctcggttttactcacaatgaggatgcgaaaagatacatccggcaacttcccaac
ttcccacgtcagcccttagctaaacttttctctcatgttaacccaatggccattgatctt
gttgacagaatgttgacgtttgaccccaacagaagaatcactgttgaacaagctctgaat
caccagtaccttgctaaattgcacgacccgaatgatgagccaatctgtcaaaagccattc
tcttttgagttcgaacaacagcctctggatgaggaacagataaaagagatgatctaccaa
gaagccatagcactcaatccaacatacggttag

KEGG   Arabidopsis thaliana (thale cress): AT3G59790
Entry
AT3G59790         CDS       T00041                                 

Gene name
MPK10
Definition
(RefSeq) MAP kinase 10
  KO
K14512  mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04016  MAPK signaling pathway - plant
ath04075  Plant hormone signal transduction
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    AT3G59790 (MPK10)
   04075 Plant hormone signal transduction
    AT3G59790 (MPK10)
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT3G59790 (MPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT3G59790 (MPK10)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AT3G59790 (MPK10)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   AT3G59790 (MPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Haspin_kinase Kinase-like ABC1 FTA2
Other DBs
NCBI-GeneID: 825148
NCBI-ProteinID: NP_191538
MIPS: AT3G59790.1
TAIR: AT3G59790
UniProt: Q9M1Z5
LinkDB
Position
3
AA seq 393 aa
MEPTNDAETLETQGEVTTAIWPSSQILKTTIDIPGTLSHDGRYIQYNLFGHIFELPAKYK
PPIRPIGRGACGIVCSAVDSETNEKVAIKKITQVFDNTIEAKRTLREIKLLRHFDHENIV
AIRDVILPPQRDSFEDVYIVNELMEFDLYRTLKSDQELTKDHGMYFMYQILRGLKYIHSA
NVLHRDLKPSNLLLSTQCDLKICDFGLARATPESNLMTEYVVTRWYRAPELLLGSSDYTA
AIDVWSVGCIFMEIMNREPLFPGKDQVNQLRLLLELIGTPSEEELGSLSEYAKRYIRQLP
TLPRQSFTEKFPNVPPLAIDLVEKMLTFDPKQRISVKEALAHPYLSSFHDITDEPECSEP
FNFDLDEHPFSEEQFRELIYCEALAFNPETSND
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggagccaactaacgatgctgagacattggaaactcaaggagaggttacaaccgctatt
tggccgtcatctcaaatcctcaagacgactatcgatattccggggactctcagccatgac
ggcagatacatccagtacaatctatttgggcatatctttgaactccccgcaaagtataag
ccaccgattaggcctattggcagaggtgcttgtggcatcgtttgttcggctgtggactcc
gagaccaatgagaaggtagcaataaagaaaataacgcaagtatttgataacactatcgaa
gcaaagagaactcttcgtgaaatcaagcttcttcgtcacttcgatcatgagaatattgtt
gcaatcagagacgtaatcttgcctcctcagagagattcattcgaagatgtttacattgtg
aatgaattgatggagtttgacctttatcgaaccttaaaatcagatcaagaactaaccaaa
gatcatggcatgtatttcatgtaccaaatcctgcgcggattaaagtacattcattcagcc
aatgtgctacacagagatctaaaaccaagcaatctcctcttgagtacacaatgtgactta
aagatttgtgatttcgggctcgctcgtgcaactcctgagagtaatttaatgactgagtat
gttgtcacaagatggtaccgtgcacctgagcttctgttgggctcttctgactataccgca
gcaatagatgtttggtctgttggctgtattttcatggaaataatgaaccgtgaaccgctc
ttcccggggaaagatcaagttaatcagcttcgtttgcttctggagctcattggcactcca
tctgaagaagagcttggatcgttgagtgaatacgctaagcgatacataaggcagcttcct
acgcttcctcgccaatctttcactgagaaattcccgaacgtgcctcccttagcaatagac
ttggtggagaagatgctaacatttgatcctaaacagagaatctcagttaaagaagcactt
gctcatccataccttagctcgtttcacgacattaccgatgaaccagagtgctcagagccc
ttcaatttcgatttagatgaacatccattctctgaggagcagtttagagagttaatctac
tgtgaagccctagctttcaaccctgaaaccagcaatgattga

DBGET integrated database retrieval system