KEGG   Arabidopsis thaliana (thale cress): AT2G44140
Entry
AT2G44140         CDS       T00041                                 
Name
(RefSeq) Peptidase family C54 protein
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT2G44140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT2G44140
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT2G44140
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT2G44140
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-
     AT2G44140
Peptidases and inhibitors [BR:ath01002]
 Cysteine peptidases
  Family C54: Aut2 peptidase family
   AT2G44140
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AT2G44140
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT2G44140
SSDB
Motif
Pfam: Peptidase_C54
Other DBs
NCBI-GeneID: 819020
NCBI-ProteinID: NP_001324765
TAIR: AT2G44140
UniProt: Q8S929 A0A178VZV2
LinkDB
Position
2:complement(18253497..18258293)
AA seq 467 aa
MKALCDRFVPQQCSSSSKSDTHDKSPLVSDSGPSDNKSKFTLWSNVFTSSSSVSQPYRES
STSGHKQVCTTRNGWTAFVKRVSMASGAIRRFQERVLGPNRTGLPSTTSDVWLLGVCYKI
SADENSGETDTGTVLAALQLDFSSKILMTYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFA
QALLFHRLGRAWTKKSELPEQEYLETLEPFGDSEPSAFSIHNLIIAGASYGLAAGSWVGP
YAICRAWESLACKKRKQTDSKNQTLPMAVHIVSGSEDGERGGAPILCIEDATKSCLEFSK
GQSEWTPIILLVPLVLGLDSVNPRYIPSLVATFTFPQSVGILGGKPGASTYIVGVQEDKG
FYLDPHEVQQVVTVNKETPDVDTSSYHCNVLRYVPLESLDPSLALGFYCRDKDDFDDFCL
RALKLAEESNGAPLFTVTQTHTAINQSNYGFADDDSEDEREDDWQML
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgaaggctttatgtgatagatttgttcctcaacaatgttcttcatcaagcaagagtgat
acgcatgataaatcccctttagtttcagattctggacctagtgataataagtccaagttt
accttatggtcaaacgtgtttacgtcttcttcctcagtttctcaaccgtatagggagtct
tcaacttctgggcataagcaagtttgcaccactcgtaatggttggacagcatttgtaaaa
agagtctctatggctagtggagcaattaggagattccaggagcgtgttttagggcctaat
aggaccggtcttccgagcacaactagtgacgtatggctcttgggtgtctgctataaaata
tctgcggatgagaactcaggggaaaccgatactggcactgtattggctgcattgcaacta
gatttttcatccaaaatactgatgacatatcgtaaaggttttgaaccctttagagacaca
acttataccagcgatgtgaactggggttgcatgattcgaagtagccagatgctttttgct
caggcgttgcttttccataggctggggagggcttggactaagaaatctgagcttcctgaa
caggaatacttagagaccttggaaccttttggtgattccgagccttcagctttctccatc
cacaatcttataatagctggagcgtcctatggtctcgctgctgggtcatgggtaggaccg
tatgccatttgtcgagcgtgggagtcattagcgtgcaagaagagaaaacaaactgattct
aaaaaccagacgcttcctatggctgttcatatcgtttctggcagcgaagatggagagaga
ggtggggctccaattctctgtatagaagatgctaccaaatcttgtctagaattctcaaaa
ggacagtctgagtggacaccgattatccttttggttccactggttcttgggcttgacagt
gtgaatcccaggtacattccatctctcgtagccacattcacttttcctcagagcgtgggg
attttgggtggcaaaccaggtgcctcaacttacatagttggtgttcaagaagacaaaggt
ttctaccttgatccgcatgaagttcaacaggtggtcacagtcaacaaggaaacaccagat
gttgacacatcctcctatcattgcaatgtccttcgttatgttcctttggaatcactcgac
ccatctctagctctaggattctattgccgcgacaaagatgatttcgacgatttctgtctc
cgagcattgaaactagctgaggaatcaaacggtgctccattgttcacagtgactcaaacc
cacacagcgataaaccaaagcaactacgggtttgcggatgacgacagcgaggatgaacgt
gaagatgactggcaaatgctctga

KEGG   Arabidopsis thaliana (thale cress): AT3G59950
Entry
AT3G59950         CDS       T00041                                 
Name
(RefSeq) Peptidase family C54 protein
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G59950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT3G59950
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G59950
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G59950
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-
     AT3G59950
Peptidases and inhibitors [BR:ath01002]
 Cysteine peptidases
  Family C54: Aut2 peptidase family
   AT3G59950
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AT3G59950
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT3G59950
SSDB
Motif
Pfam: Peptidase_C54
Other DBs
NCBI-GeneID: 825165
NCBI-ProteinID: NP_191554
TAIR: AT3G59950
UniProt: Q9M1Y0 A0A178VJJ3
LinkDB
Position
3:complement(22144280..22147712)
AA seq 477 aa
MKAICDRFVPSKCSSSSTSEKRDISSPTSLVSDSASSDNKSNLTLCSDVVASSSPVSQLC
REASTSGHNPVCTTHSSWTVILKTASMASGAIRRFQDRVLGPSRTGISSSTSEIWLLGVC
YKISEGESSEEADAGRVLAAFRQDFSSLILMTYRRGFEPIGDTTYTSDVNWGCMLRSGQM
LFAQALLFQRLGRSWRKKDSEPADEKYLEILELFGDTEASAFSIHNLILAGESYGLAAGS
WVGPYAVCRSWESLARKNKEETDDKHKSFSMAVHIVSGSEDGERGGAPILCIEDVTKTCL
EFSEGETEWPPILLLVPLVLGLDRVNPRYIPSLIATFTFPQSLGILGGKPGASTYIVGVQ
EDKGFYLDPHDVQQVVTVKKENQDVDTSSYHCNTLRYVPLESLDPSLALGFYCQHKDDFD
DFCIRATKLAGDSNGAPLFTVTQSHRRNDCGIAETSSSTETSTEISGEEHEDDWQLL
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgaaggctatatgtgatagatttgttccttcaaaatgttcttcatcaagcacaagtgaa
aagcgtgatatatcatccccgacatctctagtttcagattccgcgtctagtgataacaag
tcaaacttgacgttatgctcggatgtggttgcctcttcctccccagtttctcaactgtgt
agggaagcttcaacttcagggcataacccagtttgcaccacacatagtagttggacagtt
attttaaaaacagcttctatggctagcggggcaattaggagatttcaagaccgtgtatta
gggccgagtaggacgggtatttccagcagtactagtgagatatggctcctgggtgtctgt
tataaaatctcagagggtgaatcctcagaagaagcagatgctggccgtgtattggccgca
ttcagacaagatttttcatccttaatactgatgacatatcgtagaggttttgagcctatt
ggagacacaacttatactagtgatgtaaactggggttgcatgcttcgaagcggccagatg
ctcttcgcacaggcgttgctatttcaaaggctgggaaggtcttggaggaaaaaggattcc
gagcccgcggatgagaaatacttagagatcttagaactttttggtgatactgaggcttca
gcattctcgattcacaatcttatactagctggagaatcttatggcctggctgctgggtca
tgggtaggaccatatgctgtttgtcgatcatgggaatcattagctcggaagaacaaagaa
gaaactgatgataagcacaagtcgttttccatggctgttcatatcgtttctggcagtgaa
gacggagagagaggtggagctccaattctctgtattgaagatgtcaccaaaacttgtttg
gaattttcagaaggagaaactgagtggccgccaattcttctcttggtccctctggttctc
gggcttgacagagtgaaccccaggtacattccatctctgatagccactttcacgttccct
caaagcctcggcattttgggcggcaaaccaggtgcatcaacttacatagttggagttcaa
gaagacaaaggtttctaccttgatccgcatgatgttcaacaggtagtgacagtcaagaaa
gaaaatcaagatgttgacacatcgtcttaccattgcaataccctccgttatgttccactt
gagtcactcgacccgtcactagctctcggattctattgccagcacaaagatgattttgat
gatttctgtatccgagcaacaaagctagccggagactctaatggtgctcctctcttcact
gtgactcaatctcacagaagaaatgactgcgggattgcagaaaccagcagcagtacagag
acatctacagagatctctggtgaggaacatgaagatgactggcaattactttga

DBGET integrated database retrieval system