KEGG   Arabidopsis thaliana (thale cress): AT2G46830
Entry
AT2G46830         CDS       T00041                                 
Symbol
CCA1
Name
(RefSeq) circadian clock associated 1
  KO
K12134  circadian clock associated 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT2G46830 (CCA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT2G46830 (CCA1)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    AT2G46830 (CCA1)
SSDB
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_7 Myb_DNA-bind_6 Phasin
Other DBs
NCBI-GeneID: 819296
NCBI-ProteinID: NP_850460
TAIR: AT2G46830
UniProt: P92973 A0A178VLU6
LinkDB
Position
2:19245591..19248915
AA seq 608 aa
METNSSGEDLVIKTRKPYTITKQRERWTEEEHNRFIEALRLYGRAWQKIEEHVATKTAVQ
IRSHAQKFFSKVEKEAEAKGVAMGQALDIAIPPPRPKRKPNNPYPRKTGSGTILMSKTGV
NDGKESLGSEKVSHPEMANEDRQQSKPEEKTLQEDNCSDCFTHQYLSAASSMNKSCIETS
NASTFREFLPSREEGSQNNRVRKESNSDLNAKSLENGNEQGPQTYPMHIPVLVPLGSSIT
SSLSHPPSEPDSHPHTVAGDYQSFPNHIMSTLLQTPALYTAATFASSFWPPDSSGGSPVP
GNSPPNLAAMAAATVAAASAWWAANGLLPLCAPLSSGGFTSHPPSTFGPSCDVEYTKAST
LQHGSVQSREQEHSEASKARSSLDSEDVENKSKPVCHEQPSATPESDAKGSDGAGDRKQV
DRSSCGSNTPSSSDDVEADASERQEDGTNGEVKETNEDTNKPQTSESNARRSRISSNITD
PWKSVSDEGRIAFQALFSREVLPQSFTYREEHREEEQQQQEQRYPMALDLNFTAQLTPVD
DQEEKRNTGFLGIGLDASKLMSRGRTGFKPYKRCSMEAKESRILNNNPIIHVEQKDPKRM
RLETQAST
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggagacaaattcgtctggagaagatctggttattaagactcggaagccatatacgata
acaaagcaacgtgaaaggtggactgaggaagaacataatagattcattgaagctttgagg
ctttatggtagagcatggcagaagattgaagaacatgtagcaacaaaaactgctgtccag
ataagaagtcacgctcagaaatttttctccaaggtagagaaagaggctgaagctaaaggt
gtagctatgggtcaagcgctagacatagctattcctcctccacggcctaagcgtaaacca
aacaatccttatcctcgaaagacgggaagtggaacgatccttatgtcaaaaacgggtgtg
aatgatggaaaagagtcccttggatcagaaaaagtgtcgcatcctgagatggccaatgaa
gatcgacaacaatcaaagcctgaagagaaaactctgcaggaagacaactgttcagattgt
ttcactcatcagtatctctctgctgcatcctccatgaataaaagttgtatagagacatca
aacgcaagcactttccgcgagttcttgccttcacgggaagagggaagtcagaataacagg
gtaagaaaggagtcaaactcagatttgaatgcaaaatctctggaaaacggtaatgagcaa
ggacctcagacttatccgatgcatatccctgtgctagtgccattggggagctcaataaca
agttctctatcacatcctccttcagagccagatagtcatccccacacagttgcaggagat
tatcagtcgtttcctaatcatataatgtcaacccttttacaaacaccggctctttatact
gccgcaactttcgcctcatcattttggcctcccgattctagtggtggctcacctgttcca
gggaactcacctccgaatctggctgccatggccgcagccactgttgcagctgctagtgct
tggtgggctgccaatggattattacctttatgtgctcctcttagttcaggtggtttcact
agtcatcctccatctacttttggaccatcatgtgatgtagagtacacaaaagcaagcact
ttacaacatggttctgtgcagagccgagagcaagaacactccgaggcatcaaaggctcga
tcttcactggactcagaggatgttgaaaataagagtaaaccagtttgtcatgagcagcct
tctgcaacacctgagagtgatgcaaagggttcagatggagcaggagacagaaaacaagtt
gaccggtcctcgtgtggctcaaacactccgtcgagtagtgatgatgttgaggcggatgca
tcagaaaggcaagaggatggcaccaatggtgaggtgaaagaaacgaatgaagacactaat
aaacctcaaacttcagagtccaatgcacgccgcagtagaatcagctccaatataaccgat
ccatggaagtctgtgtctgacgagggtcgaattgccttccaagctctcttctccagagag
gtattgccgcaaagttttacatatcgagaagaacacagagaggaagaacaacaacaacaa
gaacaaagatatccaatggcacttgatcttaacttcacagctcagttaacaccagttgat
gatcaagaggagaagagaaacacaggatttcttggaatcggattagatgcttcaaagcta
atgagtagaggaagaacaggttttaaaccatacaaaagatgttccatggaagccaaagaa
agtagaatcctcaacaacaatcctatcattcatgtggaacagaaagatcccaaacggatg
cggttggaaactcaagcttccacatga

DBGET integrated database retrieval system