KEGG   Arabidopsis thaliana (thale cress): AT3G03490
Entry
AT3G03490         CDS       T00041                                 
Symbol
PEX19-1
Name
(RefSeq) peroxin 19-1
  KO
K13337  peroxin-19
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G03490 (PEX19-1)
SSDB
Motif
Pfam: Pex19 DUF445 Phasin_2 SesA PilO
Other DBs
NCBI-GeneID: 821248
NCBI-ProteinID: NP_186999
TAIR: AT3G03490
UniProt: Q9SRQ3 A0A178V7Y2
LinkDB
Position
3:complement(830116..831997)
AA seq 248 aa
MANSHTDDLDELLDSALDDFKDLNLSHQRNQREAQEEEEKKRKEETVLLPSGVQGLGMGL
PDMRSKKRGKQKVSKEDHVAEALDKLREQTRETVKGLESISSKQLPASDDDGMVEDFLKQ
FEDLAGSKDLESIVETMMQQLLSKDILHEPMKELGARYPKWLKENEASLSKEDYKRYSQQ
YKLIEELNAVYENEPNNSSKIMEIMQKMQECGQPPSDIVKEIDPGFDFASLGQISPEMLE
SSPNCCIM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggcgaacagtcacaccgatgacttggacgagcttctcgatagtgcattggatgatttc
aaagatctcaatctttctcatcaaagaaatcaaagggaagctcaagaggaggaggaaaag
aagaggaaagaagagacggttttattaccgagtggagttcaaggtcttggaatgggatta
ccagatatgagaagcaagaagagaggaaaacaaaaggtttccaaagaggatcatgttgct
gaagctcttgataagcttagggaacaaactagggaaactgtcaaaggattggaatccatt
tcttctaagcagctgcctgcttctgatgatgatggaatggttgaggattttctcaaacaa
ttcgaggatcttgctggatctaaggacttggaatcaatagtcgagacgatgatgcaacag
ctattgtcgaaggatattctccacgaaccaatgaaggagcttggcgcaagatatccgaaa
tggctaaaagagaatgaagccagtctaagcaaagaagactacaaacgatattcacaacag
tacaaactaatagaagaactcaatgcagtgtacgagaatgaacctaacaattcatctaag
ataatggagatcatgcaaaagatgcaggaatgtggacaacccccgagtgatatagttaaa
gagattgatcccgggtttgatttcgcaagtcttggccaaatatccccagagatgctggag
tcctcgccaaattgctgtatcatgtga

KEGG   Arabidopsis thaliana (thale cress): AT5G17550
Entry
AT5G17550         CDS       T00041                                 
Symbol
PEX19-2
Name
(RefSeq) peroxin 19-2
  KO
K13337  peroxin-19
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G17550 (PEX19-2)
SSDB
Motif
Pfam: Pex19 SesA EcoEI_R_C
Other DBs
NCBI-GeneID: 831621
NCBI-ProteinID: NP_568351
TAIR: AT5G17550
UniProt: Q94EI3 A0A178UP73
LinkDB
Position
5:complement(5786414..5788304)
AA seq 245 aa
MANDTHTDDLDELLDSALDDFKDLNLTQRNGGVKKEEGDKKETESLPSGVQGLGMGLPDM
RSKKKGKKKIAKEDHVTEALDKLREQTRETVKGLESLSSKQQPTGSDDAMVEDWIKQFEN
LTGSNDLESIVDTMMQQLLSKDILHEPMKEIGARYPKWLEEHESSLNKEEFDRYSRQYEL
IKELNLVYENEPNNSTKIMEIMQKMQECGQPPSDIVQEMDPGFDFASLGQMSPDMLESSP
NCCVM
NT seq 738 nt   +upstreamnt  +downstreamnt
atggccaacgatactcacaccgatgacttagacgagcttctcgatagtgccttggatgat
ttcaaggatcttaatcttactcaaagaaatggaggggttaagaaagaagagggtgataaa
aaagagacagagtcattgccaagtggggttcaaggtcttggaatggggttaccagatatg
aggagtaagaagaaaggaaagaaaaagattgctaaagaggaccatgttactgaggcactt
gataaactcagggaacaaactagagaaactgtgaagggacttgagtccttgtcatcgaag
cagcaacctacaggttctgatgatgctatggttgaagattggatcaagcaattcgagaat
cttactgggtctaacgacttggagtcgatagtggacacgatgatgcaacagctgttatcg
aaggatattcttcacgaaccaatgaaagagattggtgcaagatacccaaaatggctagaa
gagcatgaatccagtctaaacaaggaagaattcgatcgttattcacgccagtatgaactt
atcaaagaactcaacttggtgtacgagaacgaaccaaacaattcgaccaagataatggag
ataatgcagaagatgcaagagtgtggacaaccaccgagtgatatagtgcaagagatggat
cctggctttgatttcgctagtctgggccaaatgtctccggacatgctcgagtcttcacca
aattgttgtgtaatgtga

DBGET integrated database retrieval system