KEGG   Arabidopsis thaliana (thale cress): AT3G06810
Entry
AT3G06810         CDS       T00041                                 
Symbol
IBR3
Name
(RefSeq) acyl-CoA dehydrogenase-like protein
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01212  Fatty acid metabolism
Module
ath_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ath_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT3G06810 (IBR3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT3G06810 (IBR3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     AT3G06810 (IBR3)
SSDB
Motif
Pfam: APH Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 Choline_kinase Kdo EcKL
Other DBs
NCBI-GeneID: 819865
NCBI-ProteinID: NP_187337
TAIR: AT3G06810
UniProt: Q8RWZ3 A0A654FFE9
LinkDB
Position
3:2146243..2150851
AA seq 824 aa
MGSSTGDLVTRIQSAHRFDHDALFRFAADNVSGFPTNPSQFKVSQFGHGQSNPTFLIEVG
SGSSLKRYVLRKKPPGKLLQSAHAVDREFQVLRALGEHTQVPVPKVFCLCTDPAVIGTAF
YIMEFMEGRIFIDPKLPNVAPERRNAIYRATAKALASLHSADVDAIGLEKYGRRGNYCKR
QIDRWFKQYLASTSEGKPERNPKMFELVDWLRKNIPAEDSTGATSGLVHGDFRIDNLVFH
PSEDRVIGIIDWELSTLGNQMCDVAYSCMHYIVNVQLDKEHVSEGFETTGLPEGMLSMPE
FLLEYCSASGKPWPAANWKFYVAFSLFRAASIYTGVYSRWLMGNASAGERARNTGVQANE
LVESALGYIARENVLPEHPPSVQRDVSPSYESLVDGSGRFIPNRKVLELRQKLIKFMETH
IYPMENEFSKLAQSDMRWTVHPQEEKLKEMAKREGLWNLFVPVDSAARARRELAATENKH
NLSGKSFDQLFGEGLTNLEYGYLCEIMGRSVWAPQVFNCGAPDTGNMEVILRYGNKEQIS
EWLIPLLEGRIRSGFAMTEPQVASSDATNIECSIRRQGDSYVINGTKWWTSGAMDPRCRV
LILMGKTDFNAPKHKQQSMILVDMRTPGISVKRPLTVFGFDDAPHGHAEISFENVVVPAK
NILLGEGRGFEIAQGRLGPGRLHHCMRLIGAAERGMELMAQRALSRKTFGKFIAQHGSFV
SDLAKLRVELEGTRLLVLEAADHLDKFGNKKARGILAMAKVAAPNMALKVLDTAIQVHGA
AGVSSDTVLAHLWATARTLRIADGPDEVHLGTIGKLELQRASKL
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgggaagcagcacgggcgatcttgtgacacgtatccaatcagctcaccgtttcgatcac
gatgccttgtttcgttttgccgccgacaacgtctctggctttccgaccaacccttcccaa
ttcaaagtctcacagttcggacatgggcagtcgaatccaacgtttctgatagaggttggc
tcagggagttccttgaaacgatacgttttgaggaagaagcctcctggcaagcttcttcaa
tctgctcatgctgttgatcgagagtttcaggtgcttcgggctttaggtgaacatacacag
gttcctgttcctaaagtcttctgcttatgcactgaccctgctgtcattgggactgctttt
tacattatggagtttatggaaggacgtattttcattgatccaaagttgccgaatgtagca
cctgaaaggagaaatgcgatctatcgtgcaaccgccaaagccttggcatctcttcactct
gctgatgtggatgccattggtcttgagaaatatggtcggcgaggcaattactgcaaaaga
cagatagataggtggttcaaacaatatttggcttcaacaagtgaaggtaaacctgaaagg
aatccaaagatgtttgagcttgttgattggttacgcaaaaacatccccgcggaagattca
actggagcaacatcaggccttgtccatggagactttcgcattgacaatctcgtttttcat
ccttctgaggatcgagttattggaataattgactgggaattgtccacgcttgggaaccaa
atgtgtgatgttgcatacagctgcatgcattacattgtgaatgttcagctcgataaggag
catgttagtgaaggttttgaaactactgggcttccagaaggaatgctttcgatgccagaa
tttctcttagaatactgttctgcatcgggaaaaccatggcctgctgcaaactggaagttc
tacgtagcgttctccttatttcgggctgcttcaatctacacaggggtgtacagtagatgg
ttaatggggaatgcttctgccggtgaaagagcgcgaaatacaggggttcaagctaatgag
cttgtagagtctgccttgggttatattgcacgtgaaaatgttcttccagaacaccctcca
tctgttcaaagagacgtgtctccgtcgtatgaaagccttgtggatggaagcgggagattc
atccccaacagaaaagtattggagttaaggcagaagttgatcaagtttatggaaactcat
atctacccaatggaaaacgagttctccaaacttgctcaatcagatatgcgatggaccgtt
caccctcaggaggaaaagttaaaggaaatggcaaagagagaaggcctatggaacttattt
gttcctgtagatagtgctgctagagctagaagagaactggcggctaccgagaataaacat
aacctctcgggcaagtcttttgatcaattgtttggtgagggcctcacgaacctggagtat
ggttacctttgtgagatcatgggtcgttctgtttgggctccacaggtgtttaactgtggt
gcaccagatactggaaacatggaggtgatactgcggtatggtaacaaagaacaaatttct
gaatggcttattccgttgctcgagggaagaattcgttctggatttgctatgactgagcca
caagttgcatcgtctgatgcaaccaatattgaatgctctatccgaagacaaggtgattca
tacgtcattaatggcacaaaatggtggacaagtggagctatggatcccaggtgcagagtc
cttattctcatgggaaaaactgatttcaacgccccaaaacataagcagcagtctatgata
ttagtggacatgcggactccaggtataagtgtgaagaggcctctcacagtgtttggtttt
gatgacgcacctcatggacatgctgaaatttcttttgaaaatgtggttgtcccggcgaag
aacattctccttggagaaggccgaggattcgagattgctcagggtaggttaggccctgga
agactgcaccattgcatgagactaataggtgcagcagagcgtggaatggagctaatggct
caaagagctctgagtagaaaaacttttgggaagttcattgcgcagcacggttctttcgtc
tctgatcttgcaaagttacgggtagagctagaaggaacccgattgttggttctagaagct
gctgatcatcttgataaatttggaaacaaaaaagctcgaggaattctcgcaatggccaag
gttgcagctccaaacatggcattgaaggtactagacacggcaatacaagttcatggagca
gccggtgtatcctcggacacagttttagcgcatttgtgggctacagctagaacactgagg
attgctgatggacctgatgaggttcatcttgggaccattggcaagttagaactgcaaaga
gcttcaaagctttaa

DBGET integrated database retrieval system