KEGG   Arabidopsis thaliana (thale cress): AT3G06860
Entry
AT3G06860         CDS       T00041                                 
Symbol
MFP2
Name
(RefSeq) multifunctional protein 2
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00592  alpha-Linolenic acid metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01212  Fatty acid metabolism
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT3G06860 (MFP2)
   00592 alpha-Linolenic acid metabolism
    AT3G06860 (MFP2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AT3G06860 (MFP2)
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     AT3G06860 (MFP2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AT3G06860 (MFP2)
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 F420_oxidored
Other DBs
NCBI-GeneID: 819870
NCBI-ProteinID: NP_187342
TAIR: AT3G06860
UniProt: Q9ZPI5
Structure
LinkDB
Position
3:2161735..2166357
AA seq 725 aa
MDSRTKGKTVMEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGA
KGRFSGGFDISGFGEMQKGNVKEPKAGYISIDIITDLLEAARKPSVAAIDGLALGGGLEL
AMACHARISAPAAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMILTSKPVKAEEGHS
LGLIDAVVPPAELVTTARRWALDIVGRRKPWVSSVSKTDKLPPLGEAREILTFAKAQTLK
RAPNMKHPLMCLDAIEVGIVSGPRAGLEKEAEVASQVVKLDTTKGLIHVFFSQRGTAKVP
GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQ
SRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH
CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRTNHTSAQVIVDLLDVG
KKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVECGADPYLIDRAISKFGMPMGPFRLCD
LVGFGVAIATATQFIENFSERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPEL
KKYIEKARSISGVKLDPKLANLSEKDIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIM
GMGFPPYRGGIMFWADSIGSKYIYSRLDEWSKAYGEFFKPCAFLAERGSKGVLLSAPVKQ
ASSRL
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggattcacgaaccaaggggaagacggtgatggaagttggtggcgatggcgttgccgtc
ataacactcatcaatcctcccgtcaattctctatccttcgacgtgctatacaatctcaaa
agtaattacgaggaggccttgagcaggaatgatgttaaagctattgttattactggtgca
aaggggaggttctctggtggctttgatatatctggttttggtgaaatgcagaaggggaat
gtcaaagagccaaaggctggttacatttcgattgacatcataaccgacttgcttgaagct
gctaggaaaccgtctgtcgctgccattgatggacttgccttgggaggaggattagaactt
gctatggcttgtcatgctaggatatcagctcctgctgcacagttaggcttgcctgagctg
caacttggtgttattcctggttttggaggaacgcagcgtctcccgcgtcttgttggtctc
accaaagcccttgaaatgattttgacatctaagccagttaaagctgaggaaggtcattct
ttgggtcttattgatgctgtggtgccacctgcggagttagtaaccactgctcgtcgctgg
gcccttgacatagtcgggaggagaaaaccatgggtatctagtgtttccaagactgataag
ttacctcctcttggagaggcaagggagatactgacgtttgccaaggcacagacactcaag
cgtgcccccaatatgaaacaccctttaatgtgccttgacgctattgaagtaggtattgtt
tctggtccaagggctggtttagaaaaggaagctgaagtcgcctcacaagtggtaaaactg
gataccaccaaaggcttgatccacgtcttcttttctcagcgaggaactgctaaggttcct
ggagttactgatcgtgggttggtgccaaggaagattaagaaggtagccataattggaggc
gggttgatgggatctggaatagctactgcgttgatcctaagtaactatccagtgattctc
aaggaggtaaatgagaaattcctggaggctggaattggcagagttaaagctaatctccag
agccgtgtaaggaagggaagcatgtctcaggaaaagtttgagaaaaccatgtctctcctt
aagggttctcttgattatgaaagctttagagatgtggacatggtcattgaggctgttatt
gagaatatatctttgaagcaacaaatttttgctgatctggagaaatactgtcctcagcat
tgtatccttgctagcaacacatcgaccattgacttgaacaaaattggggagcggaccaag
tctcaggatcgaattgttggagcacattttttcagtccagcacatatcatgccgctactt
gaaatagttcggaccaatcatacctctgcccaagtaattgttgacctgttagatgttggg
aagaagattaagaaaacaccagttgtggtgggaaactgcacagggtttgcagtgaatagg
atgttcttcccttacacacaggcagctatgttccttgttgagtgtggagcagatccatat
ctaatcgacagggcaatcagcaagtttggaatgccaatgggtcccttcagactgtgtgac
ctggttggatttggtgtggcgattgcaaccgcaacgcagtttatcgagaacttctcagaa
cggacttacaaatcaatgattattccacttatgcaagaggacaagagagctggtgaagcc
actcgcaaaggtttctatttgtatgatgataagcgcaaggcgaaacctgatcctgagcta
aagaaatatatcgaaaaggcaagaagcatatctggagtaaagcttgaccctaagttggcg
aatttgtcggagaaggacattattgaaatgacattcttcccagtagtaaacgaggcgtgt
agggtttttgctgaaggtatcgctgtcaaagcagcagaccttgacattgctggcataatg
ggaatgggttttccaccttacagaggaggaatcatgttctgggctgattccatcggatcg
aaatacatttactcgaggctggatgagtggtcgaaggcttatggtgaattcttcaagcct
tgtgcttttttggctgagaggggatctaaaggagttcttttgagcgctcccgtgaaacaa
gccagctcacggttgtaa

KEGG   Arabidopsis thaliana (thale cress): AT4G16210
Entry
AT4G16210         CDS       T00041                                 
Symbol
ECHIA
Name
(RefSeq) enoyl-CoA hydratase/isomerase A
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath00310  Lysine degradation
ath00360  Phenylalanine metabolism
ath00380  Tryptophan metabolism
ath00410  beta-Alanine metabolism
ath00640  Propanoate metabolism
ath00650  Butanoate metabolism
ath00903  Limonene and pinene degradation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01212  Fatty acid metabolism
Module
ath_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT4G16210 (ECHIA)
   00650 Butanoate metabolism
    AT4G16210 (ECHIA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT4G16210 (ECHIA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT4G16210 (ECHIA)
   00310 Lysine degradation
    AT4G16210 (ECHIA)
   00360 Phenylalanine metabolism
    AT4G16210 (ECHIA)
   00380 Tryptophan metabolism
    AT4G16210 (ECHIA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT4G16210 (ECHIA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AT4G16210 (ECHIA)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AT4G16210 (ECHIA)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 827314
NCBI-ProteinID: NP_193356
TAIR: AT4G16210
UniProt: Q6NL24 A0A654FQ16
LinkDB
Position
4:complement(9176499..9178139)
AA seq 265 aa
MDQTVSENLIQVKKESGGIAVITINRPKSLNSLTRAMMVDLAKAFKDMDSDESVQVVIFT
GSGRSFCSGVDLTAAESVFKGDVKDPETDPVVQMERLRKPIIGAINGFAITAGFELALAC
DILVASRGAKFMDTHARFGIFPSWGLSQKLSRIIGANKAREVSLTSMPLTADVAGKLGFV
NHVVEEGEALKKAREIAEAIIKNEQGMVLRIKSVINDGLKLDLGHALTLEKERAHAYYSG
MTKEQFRKMQEFIAGRGSKKPSSKL
NT seq 798 nt   +upstreamnt  +downstreamnt
atggatcaaacagtatcggaaaatctcattcaggtgaagaaagaatcaggcgggatcgcc
gtcatcacaatcaaccgtccgaaatctctcaattcactcacgagagcgatgatggttgat
ctcgccaaggcattcaaggatatggactccgacgaatcggtccaggtcgtgattttcacc
ggatcaggtcgatctttctgctctggcgttgatttgactgcggcggagtctgttttcaaa
ggagacgtgaaggatccggaaaccgacccggttgtgcagatggagcggttacgtaaaccg
atcatcggagctattaacggttttgccatcaccgccgggtttgaactcgccttggcctgt
gatattttggtcgcttctagaggagctaagttcatggatactcacgccaggtttgggata
tttccttcatggggtttgtctcagaagctgtcgaggatcatcggagcaaacaaagctcga
gaagtttctttaacatcgatgccactgacagcagacgtggctgggaagttagggtttgta
aaccatgtggttgaagaaggagaagcgttaaagaaagctagagaaatcgcagaggctata
atcaagaatgaacaaggcatggttctgaggattaaatccgttatcaatgatggacttaag
cttgatcttgggcatgctctcacactagaaaaggagcgagctcacgcgtattacagtggg
atgacgaaggaacagtttagaaagatgcaggagtttatagccggacgtggatccaagaaa
ccttcttctaagttgtag

KEGG   Arabidopsis thaliana (thale cress): AT4G29010
Entry
AT4G29010         CDS       T00041                                 
Symbol
AIM1
Name
(RefSeq) Enoyl-CoA hydratase/isomerase family
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00592  alpha-Linolenic acid metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01212  Fatty acid metabolism
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT4G29010 (AIM1)
   00592 alpha-Linolenic acid metabolism
    AT4G29010 (AIM1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AT4G29010 (AIM1)
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     AT4G29010 (AIM1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AT4G29010 (AIM1)
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Peptidase_S49 Pyr_redox_2 DAO
Other DBs
NCBI-GeneID: 829022
NCBI-ProteinID: NP_194630
TAIR: AT4G29010
UniProt: Q9ZPI6 A0A178UXN1
LinkDB
Position
4:complement(14297044..14302287)
AA seq 721 aa
MAKKIGVTMEVGNDGVAVITISNPPVNSLASPIISGLKEKFRDANQRNDVKAIVLIGNNG
RFSGGFDINVFQQVHKTGDLSLMPEVSVELVCNLMEDSRKPVVAAVEGLALGGGLELAMA
CHARVAAPKAQLGLPELTLGVIPGFGGTQRLPRLVGLAKATDMILLSKSISSEEGHKLGL
IDALVPPGDVLSTSRKWALDIAEGRKPFLQSLHRTDKIGSLSEARAILKNSRQLAKKIAP
NMPQHHACIEVIEEGIIHGGYSGVLKEAEVFKQLVLSDTAKGLVHVFFAQRATSKVPNVT
DVGLKPRPIKKVAVIGGGLMGSGIATALLLSNIRVVLKEINSEFLMKGIKSVEANMKSLV
SRGKLTQDKAGKALSLFKGVLDYTEFNDVDMVIEAVIENIQLKQNIFKEIEKVCSPHCIL
ASNTSTIDLDVIGEKTNSKDRIVGAHFFSPAHLMPLLEIVRSKNTSAQVILDLMAVGKAI
KKVPVVVGNCIGFAVNRTFFPYSQAAHMLANLGVDLFRIDSVITSFGLPLGPFQLGDLAG
HGIGLAVGPIYAKVYGDRMFRSPMTELLLKSGRNGKINGRGYYIYEKGSKPKPDPSVLSI
VEKSRKLTNIMPGGKPISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLGMS
FPSYRGGIVFWADTVGPKYIYERLKKLSETYGSFFKPSRYLEERAMNGMLLSESKSSRSK
L
NT seq 2166 nt   +upstreamnt  +downstreamnt
atggcgaagaagattggagtaacgatggaagttgggaacgatggtgttgctgtcatcacc
atttctaaccctcctgttaactctttagccagtccaattatttctgggttgaaggagaag
tttcgtgacgccaatcaaaggaatgatgttaaggccatcgtgttgatcgggaacaatgga
agattttcgggtggttttgatatcaatgtctttcagcaagttcataagactggggattta
tcgcttatgcctgaagtatctgttgagcttgtgtgtaacctgatggaagactccaggaag
ccggttgttgctgcagttgaaggattagctcttggtggtggtttggaacttgcaatggcg
tgtcatgccagagttgctgctccgaaagctcaattaggcttaccagaactgactcttgga
gtgattcctggttttggaggaacccaacgtcttccaaggttagtaggccttgcaaaagca
acggatatgatactgctttctaagtcaatatcctcagaagaggggcacaaactgggtctc
attgatgccttggtgccacctggagatgtgttgagcacatccagaaagtgggctctagac
attgcagagggacgtaaaccctttctgcagtcactgcacagaaccgacaaaattggttct
ttatctgaagctcgtgctatattgaagaattcaagacagctagccaagaagattgcccca
aatatgcctcagcaccatgcttgcattgaggtgattgaagaaggaatcatccatggagga
tacagtggggttctcaaggaagcagaagttttcaagcaactagtactgtcagacactgca
aagggtcttgttcatgttttctttgcacaacgtgcaacatcaaaagtgcctaatgtaact
gacgttggattgaaaccaaggccgataaaaaaagttgcagttattggtggcggtctgatg
ggttcaggcatcgctacggctctacttctaagcaatataagagttgtgctcaaagaaata
aactcagaattccttatgaagggaataaaatcagttgaagcaaatatgaaaagcttggta
tctagggggaaactgacacaagataaagcaggaaaggccctctctttgttcaagggagta
cttgattacacagaattcaatgatgtggacatggtcatagaggcagtgattgaaaacatt
caattgaaacaaaacatattcaaagaaatcgaaaaggtttgttcaccccactgcattttg
gcgagtaatacatctactatcgacctcgatgtaattggtgaaaagactaactcaaaagat
cgcattgttggcgcacatttcttcagtccggcccatctgatgccccttctcgagattgtt
cgttcaaagaatacttctgctcaggtgattctggatctcatggcggttggaaaggccata
aagaaagttcccgtggtggttggaaactgcataggctttgcagtgaataggacattcttt
ccttattcacaagctgcacatatgttggccaatctaggtgttgacttgttcagaattgac
agcgttattacctctttcggcttgccattgggccctttccagcttggtgatttggctgga
cacgggattggattagcagttgggccgatatatgccaaggtctatggtgaccgcatgttc
agatctccaatgacagagcttcttcttaagagcgggcgaaatggaaaaatcaacggaaga
ggatactatatatacgaaaagggaagcaaaccaaaacctgatccatcagtgctttcaatt
gttgagaaatcaaggaaactgaccaatatcatgcctggtgggaagcctatatcagtaact
gataaagaaattgtagagatgatcttattccctgttgtcaacgaggcatgccgcgtccta
gatgaaggagttgtgatccgagcctcagacttggacattgcgtctgtccttggaatgagt
tttccttcttaccggggaggaattgttttctgggcagacactgttggaccaaagtacata
tatgagaggctcaagaaattgtcggagacttatggcagctttttcaaaccatcgaggtat
ctggaggaaagagcaatgaatggaatgcttttgagtgaatcgaaatcgtcgaggtccaaa
ttgtga

DBGET integrated database retrieval system