KEGG   Arabidopsis thaliana (thale cress): AT3G06860
Entry
AT3G06860         CDS       T00041                                 
Symbol
MFP2
Name
(RefSeq) multifunctional protein 2
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00592  alpha-Linolenic acid metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01212  Fatty acid metabolism
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT3G06860 (MFP2)
   00592 alpha-Linolenic acid metabolism
    AT3G06860 (MFP2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AT3G06860 (MFP2)
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     AT3G06860 (MFP2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AT3G06860 (MFP2)
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 F420_oxidored
Other DBs
NCBI-GeneID: 819870
NCBI-ProteinID: NP_187342
TAIR: AT3G06860
UniProt: Q9ZPI5
Structure
LinkDB
Position
3:2161735..2166357
AA seq 725 aa
MDSRTKGKTVMEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGA
KGRFSGGFDISGFGEMQKGNVKEPKAGYISIDIITDLLEAARKPSVAAIDGLALGGGLEL
AMACHARISAPAAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMILTSKPVKAEEGHS
LGLIDAVVPPAELVTTARRWALDIVGRRKPWVSSVSKTDKLPPLGEAREILTFAKAQTLK
RAPNMKHPLMCLDAIEVGIVSGPRAGLEKEAEVASQVVKLDTTKGLIHVFFSQRGTAKVP
GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQ
SRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH
CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRTNHTSAQVIVDLLDVG
KKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVECGADPYLIDRAISKFGMPMGPFRLCD
LVGFGVAIATATQFIENFSERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPEL
KKYIEKARSISGVKLDPKLANLSEKDIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIM
GMGFPPYRGGIMFWADSIGSKYIYSRLDEWSKAYGEFFKPCAFLAERGSKGVLLSAPVKQ
ASSRL
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggattcacgaaccaaggggaagacggtgatggaagttggtggcgatggcgttgccgtc
ataacactcatcaatcctcccgtcaattctctatccttcgacgtgctatacaatctcaaa
agtaattacgaggaggccttgagcaggaatgatgttaaagctattgttattactggtgca
aaggggaggttctctggtggctttgatatatctggttttggtgaaatgcagaaggggaat
gtcaaagagccaaaggctggttacatttcgattgacatcataaccgacttgcttgaagct
gctaggaaaccgtctgtcgctgccattgatggacttgccttgggaggaggattagaactt
gctatggcttgtcatgctaggatatcagctcctgctgcacagttaggcttgcctgagctg
caacttggtgttattcctggttttggaggaacgcagcgtctcccgcgtcttgttggtctc
accaaagcccttgaaatgattttgacatctaagccagttaaagctgaggaaggtcattct
ttgggtcttattgatgctgtggtgccacctgcggagttagtaaccactgctcgtcgctgg
gcccttgacatagtcgggaggagaaaaccatgggtatctagtgtttccaagactgataag
ttacctcctcttggagaggcaagggagatactgacgtttgccaaggcacagacactcaag
cgtgcccccaatatgaaacaccctttaatgtgccttgacgctattgaagtaggtattgtt
tctggtccaagggctggtttagaaaaggaagctgaagtcgcctcacaagtggtaaaactg
gataccaccaaaggcttgatccacgtcttcttttctcagcgaggaactgctaaggttcct
ggagttactgatcgtgggttggtgccaaggaagattaagaaggtagccataattggaggc
gggttgatgggatctggaatagctactgcgttgatcctaagtaactatccagtgattctc
aaggaggtaaatgagaaattcctggaggctggaattggcagagttaaagctaatctccag
agccgtgtaaggaagggaagcatgtctcaggaaaagtttgagaaaaccatgtctctcctt
aagggttctcttgattatgaaagctttagagatgtggacatggtcattgaggctgttatt
gagaatatatctttgaagcaacaaatttttgctgatctggagaaatactgtcctcagcat
tgtatccttgctagcaacacatcgaccattgacttgaacaaaattggggagcggaccaag
tctcaggatcgaattgttggagcacattttttcagtccagcacatatcatgccgctactt
gaaatagttcggaccaatcatacctctgcccaagtaattgttgacctgttagatgttggg
aagaagattaagaaaacaccagttgtggtgggaaactgcacagggtttgcagtgaatagg
atgttcttcccttacacacaggcagctatgttccttgttgagtgtggagcagatccatat
ctaatcgacagggcaatcagcaagtttggaatgccaatgggtcccttcagactgtgtgac
ctggttggatttggtgtggcgattgcaaccgcaacgcagtttatcgagaacttctcagaa
cggacttacaaatcaatgattattccacttatgcaagaggacaagagagctggtgaagcc
actcgcaaaggtttctatttgtatgatgataagcgcaaggcgaaacctgatcctgagcta
aagaaatatatcgaaaaggcaagaagcatatctggagtaaagcttgaccctaagttggcg
aatttgtcggagaaggacattattgaaatgacattcttcccagtagtaaacgaggcgtgt
agggtttttgctgaaggtatcgctgtcaaagcagcagaccttgacattgctggcataatg
ggaatgggttttccaccttacagaggaggaatcatgttctgggctgattccatcggatcg
aaatacatttactcgaggctggatgagtggtcgaaggcttatggtgaattcttcaagcct
tgtgcttttttggctgagaggggatctaaaggagttcttttgagcgctcccgtgaaacaa
gccagctcacggttgtaa

KEGG   Arabidopsis thaliana (thale cress): AT4G29010
Entry
AT4G29010         CDS       T00041                                 
Symbol
AIM1
Name
(RefSeq) Enoyl-CoA hydratase/isomerase family
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00592  alpha-Linolenic acid metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01212  Fatty acid metabolism
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT4G29010 (AIM1)
   00592 alpha-Linolenic acid metabolism
    AT4G29010 (AIM1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AT4G29010 (AIM1)
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     AT4G29010 (AIM1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AT4G29010 (AIM1)
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 Peptidase_S49 DAO
Other DBs
NCBI-GeneID: 829022
NCBI-ProteinID: NP_194630
TAIR: AT4G29010
UniProt: Q9ZPI6 A0A178UXN1
LinkDB
Position
4:complement(14297044..14302287)
AA seq 721 aa
MAKKIGVTMEVGNDGVAVITISNPPVNSLASPIISGLKEKFRDANQRNDVKAIVLIGNNG
RFSGGFDINVFQQVHKTGDLSLMPEVSVELVCNLMEDSRKPVVAAVEGLALGGGLELAMA
CHARVAAPKAQLGLPELTLGVIPGFGGTQRLPRLVGLAKATDMILLSKSISSEEGHKLGL
IDALVPPGDVLSTSRKWALDIAEGRKPFLQSLHRTDKIGSLSEARAILKNSRQLAKKIAP
NMPQHHACIEVIEEGIIHGGYSGVLKEAEVFKQLVLSDTAKGLVHVFFAQRATSKVPNVT
DVGLKPRPIKKVAVIGGGLMGSGIATALLLSNIRVVLKEINSEFLMKGIKSVEANMKSLV
SRGKLTQDKAGKALSLFKGVLDYTEFNDVDMVIEAVIENIQLKQNIFKEIEKVCSPHCIL
ASNTSTIDLDVIGEKTNSKDRIVGAHFFSPAHLMPLLEIVRSKNTSAQVILDLMAVGKAI
KKVPVVVGNCIGFAVNRTFFPYSQAAHMLANLGVDLFRIDSVITSFGLPLGPFQLGDLAG
HGIGLAVGPIYAKVYGDRMFRSPMTELLLKSGRNGKINGRGYYIYEKGSKPKPDPSVLSI
VEKSRKLTNIMPGGKPISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLGMS
FPSYRGGIVFWADTVGPKYIYERLKKLSETYGSFFKPSRYLEERAMNGMLLSESKSSRSK
L
NT seq 2166 nt   +upstreamnt  +downstreamnt
atggcgaagaagattggagtaacgatggaagttgggaacgatggtgttgctgtcatcacc
atttctaaccctcctgttaactctttagccagtccaattatttctgggttgaaggagaag
tttcgtgacgccaatcaaaggaatgatgttaaggccatcgtgttgatcgggaacaatgga
agattttcgggtggttttgatatcaatgtctttcagcaagttcataagactggggattta
tcgcttatgcctgaagtatctgttgagcttgtgtgtaacctgatggaagactccaggaag
ccggttgttgctgcagttgaaggattagctcttggtggtggtttggaacttgcaatggcg
tgtcatgccagagttgctgctccgaaagctcaattaggcttaccagaactgactcttgga
gtgattcctggttttggaggaacccaacgtcttccaaggttagtaggccttgcaaaagca
acggatatgatactgctttctaagtcaatatcctcagaagaggggcacaaactgggtctc
attgatgccttggtgccacctggagatgtgttgagcacatccagaaagtgggctctagac
attgcagagggacgtaaaccctttctgcagtcactgcacagaaccgacaaaattggttct
ttatctgaagctcgtgctatattgaagaattcaagacagctagccaagaagattgcccca
aatatgcctcagcaccatgcttgcattgaggtgattgaagaaggaatcatccatggagga
tacagtggggttctcaaggaagcagaagttttcaagcaactagtactgtcagacactgca
aagggtcttgttcatgttttctttgcacaacgtgcaacatcaaaagtgcctaatgtaact
gacgttggattgaaaccaaggccgataaaaaaagttgcagttattggtggcggtctgatg
ggttcaggcatcgctacggctctacttctaagcaatataagagttgtgctcaaagaaata
aactcagaattccttatgaagggaataaaatcagttgaagcaaatatgaaaagcttggta
tctagggggaaactgacacaagataaagcaggaaaggccctctctttgttcaagggagta
cttgattacacagaattcaatgatgtggacatggtcatagaggcagtgattgaaaacatt
caattgaaacaaaacatattcaaagaaatcgaaaaggtttgttcaccccactgcattttg
gcgagtaatacatctactatcgacctcgatgtaattggtgaaaagactaactcaaaagat
cgcattgttggcgcacatttcttcagtccggcccatctgatgccccttctcgagattgtt
cgttcaaagaatacttctgctcaggtgattctggatctcatggcggttggaaaggccata
aagaaagttcccgtggtggttggaaactgcataggctttgcagtgaataggacattcttt
ccttattcacaagctgcacatatgttggccaatctaggtgttgacttgttcagaattgac
agcgttattacctctttcggcttgccattgggccctttccagcttggtgatttggctgga
cacgggattggattagcagttgggccgatatatgccaaggtctatggtgaccgcatgttc
agatctccaatgacagagcttcttcttaagagcgggcgaaatggaaaaatcaacggaaga
ggatactatatatacgaaaagggaagcaaaccaaaacctgatccatcagtgctttcaatt
gttgagaaatcaaggaaactgaccaatatcatgcctggtgggaagcctatatcagtaact
gataaagaaattgtagagatgatcttattccctgttgtcaacgaggcatgccgcgtccta
gatgaaggagttgtgatccgagcctcagacttggacattgcgtctgtccttggaatgagt
tttccttcttaccggggaggaattgttttctgggcagacactgttggaccaaagtacata
tatgagaggctcaagaaattgtcggagacttatggcagctttttcaaaccatcgaggtat
ctggaggaaagagcaatgaatggaatgcttttgagtgaatcgaaatcgtcgaggtccaaa
ttgtga

DBGET integrated database retrieval system