KEGG   Arabidopsis thaliana (thale cress): AT3G07525
Entry
AT3G07525         CDS       T00041                                 
Symbol
ATG10
Name
(RefSeq) autophagocytosis-associated family protein
  KO
K17888  ubiquitin-like-conjugating enzyme ATG10
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G07525 (ATG10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G07525 (ATG10)
   04121 Ubiquitin system [BR:ath04121]
    AT3G07525 (ATG10)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G07525 (ATG10)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    AT3G07525 (ATG10)
Ubiquitin system [BR:ath04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   AT3G07525 (ATG10)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT3G07525 (ATG10)
SSDB
Motif
Pfam: Autophagy_act_C SGTA_dimer
Other DBs
NCBI-GeneID: 819941
NCBI-ProteinID: NP_850532
TAIR: AT3G07525
UniProt: Q8VZ52 A0A178V6V0
LinkDB
Position
3:complement(2398951..2400603)
AA seq 225 aa
MDSAREVSDGRLTVEGFSVASRAFADKWKIHNQSFPPWSWVPLINRTLLVSKKEEGYLSL
EKIIILSSLEEEIPEDESLNVATDCLEKEETVDHTILVPTMENEAHYYDFHIVYSASYKV
PVLYFRGYCSGGEPLALDVIKKDVPSCSVSLLLESKWTFITQEEHPYLNRPWFKLHPCGT
EDWIKLLSQSSSSSGCQMPIVLYLVSWFSVVGQVVGLRIPLEMLN
NT seq 678 nt   +upstreamnt  +downstreamnt
atggattcagctcgagaggtcagcgatggtagactcaccgtcgaaggtttctctgtagct
tctcgagcttttgccgataagtggaagatacataaccaatcgttccctccatggtcttgg
gttcctctgatcaatcgaactctacttgtttcaaagaaggaggaaggttacttgtcgctg
gagaagatcataattctcagttcacttgaggaggaaattccagaggatgaatctctaaat
gtagctactgattgcttggaaaaagaagaaacagttgatcacacgattttggtcccaacc
atggaaaatgaagcacactactatgatttccatatagtttacagtgcatcatacaaggtt
cctgtgctatattttcgcggatactgcagcggtggagaacctcttgctttggatgtcata
aaaaaagatgtaccctcatgctctgttagtcttttgctggaatctaagtggacttttata
actcaagaggagcatccatatttgaacaggccatggttcaagctacatccctgtgggact
gaggactggatcaagctgctttcccaaagtagcagctcttctggatgtcagatgccaatt
gtgttgtacttggtttcatggttctctgttgtcgggcaggtggttggtcttaggatccct
cttgagatgctgaattag

DBGET integrated database retrieval system