KEGG   Arabidopsis thaliana (thale cress): AT3G11980
Entry
AT3G11980         CDS       T00041                                 
Symbol
MS2
Name
(RefSeq) Jojoba acyl CoA reductase-related male sterility protein
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00073  Cutin, suberine and wax biosynthesis
ath01110  Biosynthesis of secondary metabolites
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    AT3G11980 (MS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G11980 (MS2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     AT3G11980 (MS2)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase GDP_Man_Dehyd
Other DBs
NCBI-GeneID: 820372
NCBI-ProteinID: NP_187805
TAIR: AT3G11980
UniProt: Q08891 A0A178VDD9
LinkDB
Position
3:3814231..3817117
AA seq 616 aa
MEALFLSSSSSSIVASNKLTRLHNHCVWSTVIRDKKRFGPTWCRVGGGGDGGRNSNAERP
IRVSSLLKDRGQVLIREQSSPAMDAETLVLSPNGNGRTIEINGVKTLMPFSGASMVGMKE
GLGIISFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVSKIYLLIKAKSKEAAIERLKNEV
LDAELFNTLKETHGASYMSFMLTKLIPVTGNICDSNIGLQADSAEEIAKEVDVIINSAAN
TTFNERYDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDC
IATENFLEGNRKALDVDREMKLALEAARKGTQNQDEAQKMKDLGLERARSYGWQDTYVFT
KAMGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLV
DPKGVLDVVPADMVVNATLAAIAKHGMAMSDPEPEINVYQIASSAINPLVFEDLAELLYN
HYKTSPCMDSKGDPIMVRLMKLFNSVDDFSDHLWRDAQERSGLMSGMSSVDSKMMQKLKF
ICKKSVEQAKHLATIYEPYTFYGGRFDNSNTQRLMENMSEDEKREFGFDVGSINWTDYIT
NVHIPGLRRHVLKGRA
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggaggctctcttcttgagttcttcttcttcctccattgtagcgtcaaacaagcttact
aggttacacaaccattgtgtctggtctacagtgattagagataagaaaaggttcggtccc
acttggtgccgtgtaggtggtggtggtgatggtgggagaaacagtaacgcagagaggcct
attcgggtttcttcgcttttgaaagacagaggtcaggtactgattagggaacagagttcg
ccggctatggatgctgagacattggttctgtctccaaacgggaatgggagaaccattgag
atcaatggagtaaagactttgatgccttttagtggcgcttctatggtggggatgaaagaa
ggacttggcataatcagtttcctccaagggaagaagtttctaatcactggctcgaccggt
ttcttagctaaagtactgattgagaaagtcttgagaatggctcctgatgtcagcaagata
tatctcttgattaaagccaaaagcaaagaagctgcgatcgagcggctaaagaacgaggtg
ttagatgcagagctttttaatactctaaaagagactcatggagcatcttacatgtctttc
atgttaactaaactcatccctgtgaccggaaacatttgcgattcaaacattgggttgcaa
gcagattcagctgaagagattgcgaaagaagttgatgttataatcaattctgctgctaat
acaaccttcaatgaaagatacgatgttgctctggacatcaacacaagagggcccggtaat
ctcatgggattcgccaagaagtgcaagaaactcaaactgttcttgcaagtatccacagct
tatgtgaatggacaaagacaaggaaggatcatggagaagccattttctatgggagattgt
atagcaacagagaacttcctcgaaggaaacagaaaagcattagatgttgatagagagatg
aagttagctcttgaagctgctagaaaagggactcaaaatcaagatgaggcacagaagatg
aaggatctcggtctagagcgggcaagatcatatggatggcaagacacttatgttttcacc
aaagcaatgggtgagatgatgatcaatagcactcgaggagacgtacctgttgttattata
aggcctagcgtcatcgaaagcacttacaaagatcctttccctggatggatggaaggaaac
aggatgatggatcctatagttttatgttacgggaaggggcaactcacggggtttttggtt
gatccaaaaggagttcttgatgtagttcctgctgatatggttgttaatgcaacgttagct
gctatagcaaagcatggaatggcaatgtcagatccggaacctgaaataaacgtgtatcag
atcgcttcttcggcgataaacccgctggttttcgaagacttagcggagcttctttataac
cactacaaaacatccccatgcatggactctaaaggtgatcctattatggtgcgtttgatg
aaacttttcaattccgttgatgatttctcggatcatttgtggagagatgctcaagaacgg
agtgggttgatgagtggtatgagttcagtggatagtaagatgatgcagaagctaaagttt
atatgcaagaaatctgttgaacaagccaaacaccttgctactatttatgagccatacact
ttctatggtggaagatttgataacagcaatacacagagattaatggagaatatgtcagag
gacgagaagagagaatttggatttgatgttggaagcattaactggacggactacattaca
aacgttcacattcccggtttaagaaggcatgtcttgaaaggaagagcttaa

KEGG   Arabidopsis thaliana (thale cress): AT3G44540
Entry
AT3G44540         CDS       T00041                                 
Symbol
FAR4
Name
(RefSeq) fatty acid reductase 4
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00073  Cutin, suberine and wax biosynthesis
ath01110  Biosynthesis of secondary metabolites
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    AT3G44540 (FAR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G44540 (FAR4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     AT3G44540 (FAR4)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase RmlD_sub_bind
Other DBs
NCBI-GeneID: 823579
NCBI-ProteinID: NP_190040
TAIR: AT3G44540
UniProt: Q9LXN3
LinkDB
Position
3:16123426..16128030
AA seq 493 aa
MDSNCIQFLHDKTILVTGVPGFLAKVFVEKILRIQPKVKKLFLLLRAADNESAMQRFHSE
VLEKDLFRVLKNALGDENLKAFITEKVVPIPGDISVDNLGVKGSDLLQHMWNEIDIIVNV
AATTNFDERYDVGLSVNTFGPLNVLNFAKKCVKGQLLLHVSTAYVRGEKSGLLHEKTFHM
GETLNGHRKLVIETEMELMKQKLKELQKQNCSEEEISQSMKDLGMSRAKLHGWPNTYVFT
KSMGEMLLGNYRENLPIVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLA
DPNSVLDLIPVDMVANAMVTAAAIHAGKLGSQTVYHVGSSCKNPITFEQIHDLAASYFTK
NPLVRRDGSSILVSKGTILSTMAQFSFYMTLRYKLPLQMLRLIYVIYPWWNGNKYKDIDR
KIKLAMRLVDLYRPYVLFKGIFDDTNTEKLRLKRKEINKEMYGLFEFDPKSIDWEDYMTT
IHIPGLITYVLKK
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggactccaattgcattcagttcctccatgacaagacgattctcgtcaccggtgttccc
ggtttcctcgccaaagtgtttgtggagaaaatattgaggattcaaccaaaggtaaagaag
cttttccttcttttgagagcagcagacaatgaatcagccatgcaacggtttcacagtgag
gttttggagaaagatctttttagagtgttgaaaaacgctttaggtgatgagaatctgaaa
gctttcataacagaaaaagtcgtacctattcccggtgatatatccgttgataatttggga
gtgaagggttctgatctcttacaacatatgtggaatgagattgatatcattgtcaatgta
gccgccacaacgaactttgatgaaagatatgatgttggtcttagcgtcaacacatttgga
ccgctcaatgtcctcaactttgccaagaagtgtgttaaaggacagttgcttcttcatgtt
tcaaccgcgtatgtgcgcggagagaagtctggacttttacatgagaaaacatttcacatg
ggggagacattgaacggacatagaaaattagtcattgagaccgaaatggagctaatgaaa
caaaaactgaaagagctacagaaacaaaattgttcagaagaagagatttcacagtctatg
aaagatcttggaatgtcaagggcaaagcttcatggatggccaaacacatatgtgtttacc
aaatcaatgggagagatgcttcttggtaattatagagaaaaccttcccatcgttatcatc
cgtcccacaatgatcactagcactttttcagaaccatttcccggttggatcgaagggtta
agaaccatagacagtgtgattgttgcatatggcaaaggaaggcttaaatgttttcttgca
gatccaaactcagtccttgatcttatacctgtggacatggtcgcaaacgcaatggtcacg
gctgcggcaatacacgcagggaagctaggttcccagaccgtgtaccatgtcggatcatct
tgtaaaaacccgatcacattcgaacagattcatgatctcgcggctagctacttcacgaaa
aaccctcttgttagacgcgatggttcatctatactagtctccaaaggaactatcttgtcc
acaatggctcagttcagtttctacatgacccttcgttacaagctacctttgcagatgttg
cgattgatatatgtaatttatccttggtggaatggtaataaatataaagacattgaccgc
aagattaagctggcgatgcggttggtcgacctctacagaccttatgtcttgtttaagggc
atatttgacgatacgaatactgagaaactgcggttgaaaagaaaggagattaataaagaa
atgtatggtttgtttgaatttgatccaaagtctattgattgggaggattatatgacgacc
attcatattcccggcctcatcacctatgtactcaaaaaataa

KEGG   Arabidopsis thaliana (thale cress): AT3G44550
Entry
AT3G44550         CDS       T00041                                 
Symbol
FAR5
Name
(RefSeq) fatty acid reductase 5
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00073  Cutin, suberine and wax biosynthesis
ath01110  Biosynthesis of secondary metabolites
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    AT3G44550 (FAR5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G44550 (FAR5)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     AT3G44550 (FAR5)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind
Other DBs
NCBI-GeneID: 823580
NCBI-ProteinID: NP_190041
TAIR: AT3G44550
UniProt: Q0WRB0 A0A654FEK0
LinkDB
Position
3:16137576..16142270
AA seq 496 aa
MELNCVQFLRNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLLVRASDNEAATKRLRTE
VFEKELFKVLRQNLGDEKLNTLLYEKVVSVPGDIATDQLGINDSHLRERMQKEIDIVVNV
AATTNFDERYDVGLGINTFGALNVLNFAKKCVKVQLLLHVSTAYVCGEKPGLIPEKPFIM
EEIRNENGLQLDINLERELMKQRLKELNEQDCSEEDITLSMKELGMERAKLHGWPNTYVF
TKSMGEMLLGKHKENLPLVIIRPTMITSTLSEPFPGWIEGLRTVDSVIIAYGKGVLKCFL
VDVNSVCDMIPVDMVANAMITAAAKHAGGSGVHMVYHVGSSHQNPVTFGEIHEIAVRYFT
KNPLRSRNGSLITVSKVRFIPTMALFSLYMTLRYKLPLQLLKLVDIIYPWRNGDKYGDKN
RKIELVMRLVELYEPYVLFKGIFDDRNTKSLCANQKEEEIKNTEKLMFDFDPKGINWGDY
LTNIHISGLVTHVLKK
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggaactcaattgtgttcaatttcttcgaaacaagacgattcttgtcaccggagctacc
ggtttccttgcgaaggtttttgtggagaaaattctgagagtgcaaccaaatgtgaagaag
ctgtaccttttggtgagagcatctgacaatgaagctgccactaaacgcttacgcacagag
gtatttgagaaagaactttttaaggtattgagacagaatcttggcgatgagaaattaaat
acattgttgtacgaaaaagttgtttcggtcccgggtgatatagcgactgatcaattaggc
ataaatgactctcatcttagagaacgtatgcaaaaagaaatagatattgttgtcaatgtt
gcagccacaacaaactttgacgaaagatatgatgttgggcttgggatcaatacatttgga
gctctcaacgtccttaactttgccaaaaaatgtgttaaagttcaattgcttctccatgtc
tcaactgcttatgtttgtggagaaaagccaggtctcatacctgaaaaaccattcatcatg
gaagagattcgtaacgagaatggtcttcaattggatattaaccttgaaagggagcttatg
aagcaaagattgaaagaactcaatgaacaagattgttccgaagaagacattactctttcc
atgaaagaactcggaatggaaagggccaagcttcatggatggcctaacacatatgttttc
accaaatcaatgggagaaatgcttcttggtaagcataaagaaaatctccccctcgtcatc
atccgtcccacgatgatcactagtactctttcggaaccttttcctggttggatcgaaggc
ttgagaactgtcgacagcgtgattattgcatatggaaagggagtgctcaagtgttttctt
gtcgatgttaactcggtctgcgatatgataccagtggatatggtggcaaacgcaatgatc
acggctgcagccaaacacgctggaggttcaggggttcacatggtgtaccatgtcggctca
tctcaccagaacccagtcacatttggagagattcatgagattgcggttcgttactttacg
aaaaaccctttgcgaagtcgcaatggctcactcataaccgtctcaaaagtgaggttcata
ccaaccatggctttgttcagcctctacatgaccctacgttacaaactacctctccagtta
ttaaaactagttgacataatatatccttggagaaacggagataaatatggagacaagaac
cgcaaaatcgagttggtgatgagattggtagagctttatgagccttatgtactcttcaag
ggaatattcgacgatagaaatacaaagagtttatgcgcaaaccagaaggaagaggagatc
aaaaatacagaaaaattgatgtttgatttcgacccaaaaggaattaattggggagattat
ctcacaaatatacacatttctggactcgtcacacacgtgcttaagaagtga

KEGG   Arabidopsis thaliana (thale cress): AT3G44560
Entry
AT3G44560         CDS       T00041                                 
Symbol
FAR8
Name
(RefSeq) fatty acid reductase 8
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00073  Cutin, suberine and wax biosynthesis
ath01110  Biosynthesis of secondary metabolites
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    AT3G44560 (FAR8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G44560 (FAR8)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     AT3G44560 (FAR8)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase Polysacc_synt_2 RmlD_sub_bind 3Beta_HSD AcylCoA_dehyd_C
Other DBs
NCBI-GeneID: 823581
NCBI-ProteinID: NP_190042
TAIR: AT3G44560
UniProt: Q1PEI6
LinkDB
Position
3:16151123..16154607
AA seq 496 aa
MEFSCVHFLQNKTILVTGATGFLAKVFVEKILRVQPNVNKLYLVVRASDNEAATKRLRTE
AFEKDLFKVLRDNLGDEKLNTLLSEKVVPVAGDIAMDHLGMKDSNLRERMQKEIDIVVNV
AATTNFDERYDIGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEKPGLLPEKPFVM
EEICNENGLQLDINLERELMKQRLKELNEQGCSEEGTTFYMKELGMERAKLHGWPNTYVF
TKSMGEMLLGNHKENLPLVIIRPTMITSTLFEPFPGWIEGLRTVDSVIIAYGKGVLKCFL
VDVNSVCDMIPADMVANAMIAAAATHAGGSKVHMVYQVGSSHQNPIIYGEIREILFCYFT
KNSLRSRNGSMITVSKMKLIPTLALFSLYMTIRYKLPVQLLKLVDIIYPSREGDEYKNKN
RKIDMVMRLVKLYEPYVLFKGIFDDRNTKNLCAKQKEEDNRNSENFMFDFDPKIIKWKDY
LINVHIPGLITHVLKK
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggaattcagttgtgttcattttcttcaaaacaagacgattcttgtcacaggcgcaacc
ggtttccttgccaaagtttttgtggagaaaatattgagagtgcaaccaaatgtgaataag
ctgtacctcgtggtgagagcatccgacaatgaagccgcgacgaaacgcttacgcacagag
gcattcgagaaagatcttttcaaggtgttaagagataatcttggcgatgagaaattgaat
acattgttgtccgaaaaagttgtcccggtcgcaggtgatatcgcgatggatcatttaggc
atgaaggactctaatctaagagaacgtatgcaaaaagaaatcgatattgttgtcaatgtc
gcagctacaactaatttcgacgagagatatgatattggtcttggaataaacacatttgga
gctctcaatgtccttaacttcgccaaaaaatgtgttaaagctcaattgcttctccatgtt
tcaactgcttatgtttgcggagaaaaaccaggtctcctacctgaaaaaccgttcgtcatg
gaagagatttgtaatgagaatggtcttcaattggatataaaccttgaaagggagctgatg
aaacaaagattgaaagaactcaatgaacaaggttgttcagaagaaggcactactttctac
atgaaagaactcggcatggaaagggcaaagcttcatggatggccaaacacatatgttttc
accaaatcgatgggagagatgcttcttggtaaccataaagaaaatcttcctctcgtcatt
atccgtcccacgatgatcactagcactctttttgaaccatttcctggttggattgaagga
ctaagaactgtagacagtgtaattattgcgtacggaaagggagtgctcaagtgttttctt
gtcgatgtaaactcggtttgcgatatgataccagcggatatggtggcaaacgcgatgatc
gcagctgcagccacacatgctggaggttcaaaggttcacatggtgtaccaagttggttca
tctcaccaaaacccaataatatatggagagatccgtgaaattttgttttgttacttcacc
aaaaactcgttgcgcagtcgcaatggctcaatgataactgtctcgaaaatgaagctgata
ccaactctggctttgttcagcctctacatgaccatacgttacaaactacctgtccagtta
ttaaaattggttgatataatatatccttcgagggaaggagacgaatacaaaaacaaaaac
cgcaagatcgatatggtgatgagattggtaaagctttacgagccttacgtactcttcaag
ggcatattcgacgataggaatactaaaaacttatgcgccaagcagaaagaagaggacaac
agaaattcagaaaattttatgtttgatttcgaccctaaaatcattaaatggaaagattat
cttataaatgtacacattcctggcctcatcactcacgtgcttaagaagtaa

KEGG   Arabidopsis thaliana (thale cress): AT3G56700
Entry
AT3G56700         CDS       T00041                                 
Symbol
FAR6
Name
(RefSeq) fatty acid reductase 6
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00073  Cutin, suberine and wax biosynthesis
ath01110  Biosynthesis of secondary metabolites
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    AT3G56700 (FAR6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G56700 (FAR6)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     AT3G56700 (FAR6)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase 3Beta_HSD KR
Other DBs
NCBI-GeneID: 824837
NCBI-ProteinID: NP_001326776
TAIR: AT3G56700
UniProt: B9TSP7
LinkDB
Position
3:complement(20999409..21002155)
AA seq 548 aa
MATTNVLATSHAFKLNGVSYFSSFPRKPNHYMPRRRLSHTTRRVQTSCFYGETSFEAVTS
LVTPKTETSRNSDGIGIVRFLEGKSYLVTGATGFLAKVLIEKLLRESLEIGKIFLLMRSK
DQESANKRLYDEIISSDLFKLLKQMHGSSYEAFMKRKLIPVIGDIEEDNLGIKSEIANMI
SEEIDVIISCGGRTTFDDRYDSALSVNALGPGRLLSFGKGCRKLKLFLHFSTAYVTGKRE
GTVLETPLCIGENITSDLNIKSELKLASEAVRKFRGREEIKKLKELGFERAQHYGWENSY
TFTKAIGEAVIHSKRGNLPVVIIRPSIIESSYNEPFPGWIQGTRMADPIILAYAKGQISD
FWADPQSLMDIIPVDMVANAAIAAMAKHGCGVPEFKVYNLTSSSHVNPMRAGKLIDLSHQ
HLCDFPLEETVIDLEHMKIHSSLEGFTSALSNTIIKQERVIDNEGGGLSTKGKRKLNYFV
SLAKTYEPYTFFQARFDNTNTTSLIQEMSMEEKKTFGFDIKGIDWEHYIVNVHLPGLKKE
FLSKKKTE
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggctaccacaaatgtcctcgccacgagccacgccttcaaattgaatggtgtcagctac
ttctcctcttttccccgcaaacctaaccactacatgcctcgtcgtcgtttatcacatact
actcgtagagtccaaacttcgtgtttttatggtgagacgtcttttgaagctgtaacgtcg
ttagttacgcctaagacagaaacaagtcgtaacagtgacggaattggaatcgtccgtttc
ttagaagggaaaagctatcttgttactggtgcaacagggtttcttgccaaagtgttgatt
gagaaactgttgagggaaagtcttgaaattgggaagatcttccttctgatgagatccaag
gatcaagaatcagcaaacaagagactctacgatgagatcataagctcggatctgttcaag
cttctgaagcaaatgcatgggagctcttacgaagctttcatgaagagaaagttgattcca
gtaattggagacattgaggaagacaatctagggatcaaatctgaaatagcaaacatgatc
agtgaggagattgatgttattatcagttgtggtggtcgtacaacattcgacgacagatac
gattctgccctaagtgtcaatgctcttggaccgggtaggctcttaagcttcggaaaagga
tgcaggaaattgaaacttttcctccatttttcaactgcttacgtgactggtaagagagag
gggacagtactagaaactcctctctgcattggagaaaacataacttctgacttgaacatc
aaatccgagctgaaactagcttcagaagctgtaagaaagttccgtggcagagaagaaatc
aagaaactcaaagaactcggttttgaaagagctcaacactatgggtgggaaaatagttac
acattcacaaaagccataggtgaggctgtaattcacagcaagcgaggaaacttgcctgta
gtgatcataaggcctagtattatcgaaagctcttacaatgagcctttccctggctggatc
caagggacaagaatggctgatccaatcatcttggcttatgccaaaggccagatttctgac
ttctgggcagatcctcaatctttgatggacattatacctgttgacatggttgcaaacgca
gcaatagcagccatggcaaagcatggttgtggtgtcccagagttcaaagtttacaattta
acttcttcatctcatgtgaaccccatgcgtgctggcaaattgatagacctctctcatcaa
catctgtgtgactttccattggaagaaacagtgatagacttagagcatatgaaaatccac
agttccttagagggtttcacttctgctttatcgaacacaataataaaacaggaaagagtg
attgataatgaaggaggaggattgagcacgaagggaaagaggaagctaaactattttgtg
tccttggcaaaaacatatgagccttacacattctttcaagctcggtttgacaacaccaat
acaacaagtctgatacaggagatgtcaatggaagagaaaaaaacgtttgggttcgatatc
aaaggcattgactgggagcattacattgtcaacgttcatcttccaggtctcaaaaaggaa
tttctttctaagaagaagactgagtaa

KEGG   Arabidopsis thaliana (thale cress): AT4G33790
Entry
AT4G33790         CDS       T00041                                 
Symbol
CER4
Name
(RefSeq) Jojoba acyl CoA reductase-related male sterility protein
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00073  Cutin, suberine and wax biosynthesis
ath01110  Biosynthesis of secondary metabolites
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    AT4G33790 (CER4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G33790 (CER4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     AT4G33790 (CER4)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD
Other DBs
NCBI-GeneID: 829521
NCBI-ProteinID: NP_567936
TAIR: AT4G33790
UniProt: Q93ZB9
LinkDB
Position
4:complement(16204096..16207956)
AA seq 493 aa
MSTEMEVVSVLKYLDNKSILVVGAAGFLANIFVEKILRVAPNVKKLYLLLRASKGKSATQ
RFNDEILKKDLFKVLKEKYGPNLNQLTSEKITIVDGDICLEDLGLQDFDLAHEMIHQVDA
IVNLAATTKFDERYDVALGINTLGALNVLNFAKRCAKVKILVHVSTAYVCGEKSGLIMET
PYRMGETLNGTTGLDINYEKKLVQEKLDQLRVIGAAPETITETMKDLGLRRAKMYGWPNT
YVFTKAMGEMMVGTKRENLSLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGKLT
CFLCDLDAVSDVMPADMVVNSILVSMAAQAGKQEEIIYHVGSSLRNPMKNSKFPELAYRY
FSIKPWTNKEGKVVKVGAIEILSSMRSFHRYMTIRYLIALKGLELVNIILCKLFEKEFQY
FNKKINFIFRLVDLYQPYLFFYGIFDDSNTEKLRKMVSKTGVENEMFYFDPKVLDWDDYF
LNTHVIGLLKYVF
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgtcgacagaaatggaggtcgttagtgttcttaagtaccttgacaacaaatccatattg
gtcgttggagctgctgggttcttagcaaatatctttgtggagaagatattaagggtggca
ccaaacgtgaagaaactctatctccttctaagagcatcaaaaggaaaatctgctacccag
aggtttaacgacgagattttgaagaaagatttgttcaaggtgctgaaggagaagtatggt
cccaatctaaatcaacttacatcagagaaaatcactattgtcgacggagacatttgcctt
gaggatttaggtcttcaagacttcgacttggctcatgagatgatccaccaagttgatgcc
attgttaatttagctgcaactactaagtttgatgaaagatacgatgtagctcttgggatc
aacacattgggtgctctcaatgtcttgaactttgccaagagatgtgcaaaggttaagatc
cttgttcatgtatcaacagcttacgtgtgcggagaaaaatctggcttgataatggaaaca
ccgtaccgtatgggtgagacgttgaatggaaccaccggtttagacatcaactacgagaaa
aaattggttcaggagaaacttgaccagctccgagtaatcggagccgctcctgaaaccatc
acggaaaccatgaaggatctcggactcagacgggcaaagatgtacggatggccaaacaca
tatgtgttcaccaaagcaatgggggagatgatggtagggacaaaaagagaaaatctgtca
cttgtgttgcttcgtccttcaattattaccagcacattcaaagaaccatttcctggttgg
actgagggcatcaggactattgatagtttagctgttggatatggcaaaggcaaactcacg
tgcttcctctgtgatcttgatgctgtttctgatgtgatgccggcagatatggtagtaaat
tcgattcttgtatcaatggccgctcaagccggtaaacaagaagagattatttaccatgtg
ggttcttcacttagaaatccgatgaaaaattcaaagtttcctgaattagcgtatcggtat
ttctcaatcaaaccgtggaccaacaaagaagggaaggtcgttaaggtcggggccattgag
atcctgagttctatgcgtagtttccatagatacatgaccatacgctacttgattgcattg
aagggacttgaattggtaaacataatactttgcaagttgtttgagaaggaatttcagtat
ttcaataagaaaataaattttatattccggcttgttgatctctatcagccttacctcttt
ttctatggaatatttgatgattcaaacacagaaaaattgcgaaaaatggtatcgaagacg
ggagtcgaaaacgagatgttttatttcgatccaaaggttctcgattgggacgactatttt
ttgaacacacatgttattgggctgcttaagtatgtcttctaa

KEGG   Arabidopsis thaliana (thale cress): AT5G22420
Entry
AT5G22420         CDS       T00041                                 
Symbol
FAR7
Name
(RefSeq) fatty acid reductase 7
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00073  Cutin, suberine and wax biosynthesis
ath01110  Biosynthesis of secondary metabolites
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    AT5G22420 (FAR7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G22420 (FAR7)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     AT5G22420 (FAR7)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase RmlD_sub_bind 3Beta_HSD
Other DBs
NCBI-GeneID: 832303
NCBI-ProteinID: NP_197634
TAIR: AT5G22420
UniProt: Q9FMQ9
LinkDB
Position
5:7429769..7432825
AA seq 409 aa
MEPNCVQFLENRTILVTGASGFLAKVLVERILRLQPNVKRLYLLVRASDKKSAEQRYDVA
LGINTFGAINVLNFAKKCVKPKLLLHVSTVYVCGERPGHIVEKHFAMGESLNGKNKVDIN
TERRLADQKSKQFKEQGCSEEETEQAMKDFGLKRARLYGWPNTYVFTKAMGEMLLGHYRE
TMPIVIIRPTIITSTFSDPFPGWIEGLKTVDSVIIFYGKGILKCFLVDQKTVCDIIPVDM
VVNAMIAIAADHCHDSGSHTVYHVGSSNQNPVIYKQIYEMMSRYFMKSPLVGRNGMLIVP
KVTRISTLARFRVYTNLRYKLPIQILGLLSVISLSQRDKFALHNRKFKMAMRLVKLYKPY
VLFKGIFDDKNMETLRIKNEAKDMEKLFGTNPKCIDWEDYFMIRISLAS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggaaccaaattgtgttcagtttcttgagaacaggacaattctcgtcactggcgcttcc
ggtttccttgctaaagttctcgtggagcggattctgagattgcaaccaaatgtgaagagg
ctctacctcctcgtaagagcatccgacaagaagtctgcggaacaacgatacgatgttgca
cttggaatcaacacatttggagcaatcaatgtccttaactttgctaagaaatgtgtgaaa
ccaaaattgcttctccatgtgtcaactgtttatgtttgtggggaaagaccgggacacata
gtagagaaacattttgcaatgggagagagccttaacggtaaaaacaaagtagacattaat
accgaaaggcgattggcagatcagaaatcaaaacaattcaaagaacaaggttgttccgag
gaagaaactgaacaagccatgaaagatttcggattaaaaagggcaagactttatgggtgg
ccaaacacatatgtcttcaccaaagcaatgggagaaatgcttcttggacactatagagaa
actatgccaattgtaatcatacgtcccacaataatcacaagcactttctcggacccattt
cctggttggattgaaggtttaaaaactgtagacagtgtgattatattctacgggaaggga
attcttaagtgttttctcgtcgatcaaaagacagtatgtgatattataccggttgatatg
gtcgtaaacgcaatgattgcaatcgcagctgaccattgccatgattctggaagtcataca
gtttaccatgtcggctcatctaaccaaaatccggtgatatataaacaaatttatgagatg
atgagtcgttatttcatgaaaagccctcttgtcggacgtaatggtatgcttatagttcca
aaagttacaagaatatccacactggctaggttccgtgtatacacaaatcttcgctataaa
ttacctatacagatattgggattacttagtgttatttccctatcccaaagagataaattt
gcacttcacaaccgtaaattcaagatggccatgagattggtgaaactttacaagccttat
gtactcttcaagggcatatttgatgataaaaacatggaaactttacgtatcaagaatgaa
gccaaagatatggagaaattgtttggcaccaaccccaaatgcattgattgggaagactat
tttatgatacgcatatccctggcctcatga

KEGG   Arabidopsis thaliana (thale cress): AT5G22500
Entry
AT5G22500         CDS       T00041                                 
Symbol
FAR1
Name
(RefSeq) fatty acid reductase 1
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00073  Cutin, suberine and wax biosynthesis
ath01110  Biosynthesis of secondary metabolites
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    AT5G22500 (FAR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G22500 (FAR1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     AT5G22500 (FAR1)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2
Other DBs
NCBI-GeneID: 832311
NCBI-ProteinID: NP_197642
TAIR: AT5G22500
UniProt: Q39152
LinkDB
Position
5:7470328..7474133
AA seq 491 aa
MESNCVQFLGNKTILITGAPGFLAKVLVEKILRLQPNVKKIYLLLRAPDEKSAMQRLRSE
VMEIDLFKVLRNNLGEDNLNALMREKIVPVPGDISIDNLGLKDTDLIQRMWSEIDIIINI
AATTNFDERYDIGLGINTFGALNVLNFAKKCVKGQLLLHVSTAYISGEQPGLLLEKPFKM
GETLSGDRELDINIEHDLMKQKLKELQDCSDEEISQTMKDFGMARAKLHGWPNTYVFTKA
MGEMLMGKYRENLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGRLKCFLADS
NSVFDLIPADMVVNAMVAAATAHSGDTGIQAIYHVGSSCKNPVTFGQLHDFTARYFAKRP
LIGRNGSPIIVVKGTILSTMAQFSLYMTLRYKLPLQILRLINIVYPWSHGDNYSDLSRKI
KLAMRLVELYQPYLLFKGIFDDLNTERLRMKRKENIKELDGSFEFDPKSIDWDNYITNTH
IPGLITHVLKQ
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggaatccaattgtgttcaatttctcggtaacaagaccattctcatcacaggagctcct
ggttttcttgccaaggttttggtagagaaaatactaaggttgcaaccaaatgtgaagaag
atataccttctgttgagagctcccgacgaaaaatcagccatgcaacgcctacgtagtgag
gttatggagatcgacctttttaaagtgttgaggaacaatctaggagaagacaatttgaat
gccttgatgcgggaaaaaattgtgccggttccaggtgatatatcgatcgataatttggga
ttgaaagacactgatctcatacaacgtatgtggagtgagattgatatcataatcaacata
gcagccacaacaaatttcgatgaaagatatgatattggtcttggcatcaacacatttgga
gccctgaatgttctcaacttcgccaaaaagtgtgttaaaggacaattgcttctccatgtc
tcaaccgcgtatataagcggtgaacaacctggattgttactagagaaaccattcaagatg
ggggagactctcagcggggatcgggaactagacatcaatatagaacatgatctaatgaaa
caaaaattgaaagagcttcaagattgttctgatgaagagatctcgcaaacaatgaaagat
tttggaatggcaagggcaaagcttcatggatggccaaatacatatgtattcaccaaagca
atgggagagatgctaatgggaaaatacagagaaaatttgccacttgttatcatacgtcca
acaatgattactagtactattgccgaaccattccccggttggattgaagggttgaaaaca
ttagacagtgtgattgttgcatatggtaaaggaaggcttaaatgttttcttgcggattca
aactcagtctttgaccttataccggcagacatggtagtaaatgcgatggttgcagccgcg
acagctcattcgggagacaccgggattcaggcaatatatcatgttggttcgtcttgtaag
aatccagtcacgtttggacaacttcacgatttcacggctcgttacttcgctaaacgtcct
ttgattggtcggaatggctcgccaatcatagtggtcaaaggaaccattctgtccactatg
gctcaattcagcctctacatgacccttcgttacaagcttcctctacagatacttcgattg
atcaatatagtttatccatggagtcacggagataactacagtgacctaagccgcaaaatc
aagctagctatgcgactagttgagctttaccagccttacttactcttcaagggcatattt
gatgatttaaataccgaaagactgcgaatgaaaagaaaggagaatatcaaagagttagat
ggatcgttcgagttcgatcccaagtccattgattgggacaattatatcacaaacacccac
attcctggcctcatcacccatgtgcttaaacaataa

DBGET integrated database retrieval system