KEGG   Arabidopsis thaliana (thale cress): AT3G14130
Entry
AT3G14130         CDS       T00041                                 
Symbol
HAOX1
Name
(RefSeq) Aldolase-type TIM barrel family protein
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath04146  Peroxisome
Module
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT3G14130 (HAOX1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G14130 (HAOX1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     AT3G14130 (HAOX1)
SSDB
Motif
Pfam: FMN_dh NMO IMPDH ThiG His_biosynth Glu_synthase DHO_dh TMP-TENI DHDPS
Other DBs
NCBI-GeneID: 820630
NCBI-ProteinID: NP_001327205
TAIR: AT3G14130
UniProt: Q9LJH5
LinkDB
Position
3:complement(4685646..4688309)
AA seq 363 aa
MDQIVNVDEFQELAKQALPKMYYDFYNGGAEDQHTLNENVQAFRRIMFRPRVLVDVSNID
MSTSMLGYPISAPIMIAPTAMHKLAHPKGEIATAKAAAACNTIMIVSFMSTCTIEEVASS
CNAVRFLQIYVYKRRDVTAQIVKRAEKAGFKAIVLTVDVPRLGRREADIKNKMISPQLKN
FEGLVSTEVRPNEGSGVEAFASSAFDASLSWKDIEWLRSITKLPILVKGLLTREDALKAV
EAGVDGIVVSNHGARQLDYSPATITVLEEVVHAVKGRIPVLLDGGVRRGTDVFKALALGA
QAVLIGRPIVYGLAAKGEDGVKKVIDMLKNEFEITMALSGCPTIDDVTRNHVRTENERIK
SML
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggatcaaatcgttaacgtggatgagtttcaagagctggccaaacaggccctccctaag
atgtactatgatttctacaatggaggagcagaggatcaacacactctcaatgaaaatgtc
caagctttccgtagaatcatgtttaggcctagggttcttgttgatgtgagcaacatagat
atgtctacaagtatgttgggttacccaatctcagctcccatcatgattgctccaacagca
atgcataagttggctcatcctaaaggagaaatcgccacagcgaaagctgcagctgcgtgt
aacactatcatgatagtatcattcatgtctacttgcactattgaggaggttgcttccagt
tgtaacgctgttcggtttcttcaaatatatgtgtacaagagacgtgatgtaacagctcag
attgtgaaaagagctgaaaaagctggattcaaggctatagttctaactgttgatgttccc
agacttggtagaagggaagcagatataaagaacaaaatgatatccccacagctgaagaat
tttgaaggcttagtttcaaccgaagtccgacctaatgaaggttcaggggttgaagccttt
gcctctagtgcatttgatgcttcgttaagctggaaggatatcgaatggttaagatctatt
acaaagttgccaattctggtcaaagggttactcacacgtgaagacgctcttaaggctgtt
gaagccggtgtagatggaatagtggtatccaaccacggggctcgccagctcgactattcc
ccggctacgataactgttttagaagaggttgttcatgctgtgaaaggtaggattccggtt
ttgcttgatggaggagtaagacgaggaacagatgttttcaaagcgctggcgctcggagca
caagctgttcttatagggaggcctatagtctatgggcttgcagctaagggtgaagatgga
gtgaaaaaagtgattgatatgctgaaaaatgagtttgagattactatggccctttctggc
tgtccaaccattgatgacgtaaccagaaaccatgttaggacagagaatgagagaattaaa
tctatgctctga

KEGG   Arabidopsis thaliana (thale cress): AT3G14150
Entry
AT3G14150         CDS       T00041                                 
Symbol
HAOX2
Name
(RefSeq) Aldolase-type TIM barrel family protein
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath04146  Peroxisome
Module
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT3G14150 (HAOX2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G14150 (HAOX2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     AT3G14150 (HAOX2)
SSDB
Motif
Pfam: FMN_dh NMO IMPDH ThiG DHO_dh Glu_synthase His_biosynth PA DHDPS TMP-TENI
Other DBs
NCBI-GeneID: 820632
NCBI-ProteinID: NP_001078152
TAIR: AT3G14150
UniProt: Q24JJ8 A0A178VKC7
LinkDB
Position
3:complement(4690415..4693133)
AA seq 363 aa
MDQIVNVDEFQELAKQALPKMYYDFYNGGAEDQHTLNENVQAFRRIMFRPRVLVDVSKID
MSTKILGYPISAPIMIAPTGNHKLAHPEGETATAKAAAACNTIMIVSYMSSCTFEEIASS
CNAVRFLQIYVYKRRDITAQVVKRAEKAGFKAIVLTVDVPRLGRREADIKNKMISPQLKN
FEGLFSTEVRPSKGSGVQAFASRAFDASFSWKDIEWLRSITELPILVKGILTREDALKAV
EAGVDGIIVSNHGGRQLDYSPATITVLEEVVQVVRGRIPVLLDGGVRRGTDVFKALALGA
QAVLIGRPIIYGLAAKGEDGVKKVIDMLKNEFEITMALSGCPTIDDITRNHVRTENERLH
SML
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggatcaaatcgttaatgtggatgagtttcaagagctggctaaacaagccctccctaag
atgtactatgatttctacaatggaggagcagaggatcaacacactctcaatgaaaatgtc
caagctttccgtagaatcatgtttaggccgagggttctcgttgatgtgagcaaaatagat
atgtctaccaaaatattgggttaccctatctctgctccaatcatgattgctccaacagga
aatcataagttggctcatcctgaaggagaaaccgctactgcgaaagctgcagctgcgtgt
aatactatcatgatagtatcatacatgtcttcatgcacttttgaggagattgcttccagt
tgtaacgctgttcggtttcttcaaatatatgtgtacaagagacgggacataactgctcag
gtggtgaaaagagctgagaaagctgggtttaaggccatagttctgactgttgatgttcct
agacttggtagaagggaagctgatataaagaacaaaatgatatccccgcagctgaagaat
ttcgaaggtttattttcaaccgaagtccgacctagtaaaggttcaggggtacaagccttc
gcctctcgtgcatttgatgcttcatttagctggaaggacattgaatggttaagatctatt
acagagttacctattctggtcaaagggatactcacccgagaagacgctcttaaggctgtt
gaagctggtgtagatggaataattgtatctaaccatgggggtcgccagctcgactattcc
cctgctacaataactgttttagaagaggttgttcaagttgttagaggtaggattccggtt
ttgcttgatggaggagtaagacgagggacagatgttttcaaagccctggcacttggagca
caagctgttcttatagggaggcctataatctatgggcttgcagctaagggtgaagatgga
gtgaaaaaagtgattgatatgttaaagaatgagtttgagattactatggctctttctggt
tgtccaaccattgatgacataaccagaaaccatgttaggacagagaatgagagacttcac
tctatgctctga

KEGG   Arabidopsis thaliana (thale cress): AT3G14415
Entry
AT3G14415         CDS       T00041                                 
Symbol
GOX2
Name
(RefSeq) Aldolase-type TIM barrel family protein
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath04146  Peroxisome
Module
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT3G14415 (GOX2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G14415 (GOX2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     AT3G14415 (GOX2)
SSDB
Motif
Pfam: FMN_dh IMPDH NMO DHO_dh ThiG Glu_synthase DUF561 His_biosynth PA
Other DBs
NCBI-GeneID: 820664
NCBI-ProteinID: NP_188059
TAIR: AT3G14415
UniProt: Q9LRS0 A0A178VBY9
LinkDB
Position
3:4818251..4821013
AA seq 367 aa
MEITNVTEYDAIAKAKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNKIDM
ATTVLGFKISMPIMVAPTAFQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTG
PGIRFFQLYVYKNRKVVEQLVRRAEKAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTL
KNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDIQWLQTITNMPILVKGVLTGEDARI
AIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRVPVFLDGGVRRGTDVFKALAL
GASGIFIGRPVVFALAAEGEAGVKKVLQMLRDEFELTMALSGCRSLSEITRNHIVTEWDT
PRHLPRL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggagatcactaacgttaccgagtatgatgcaatcgcaaaggcgaagttgcctaagatg
gtatatgactactatgcatctggtgcagaagatcaatggactcttcaagagaacagaaac
gcttttgcaagaatcctcttccggcctcggattttgattgatgtgaacaaaattgatatg
gcgactaccgtcttggggttcaagatctcgatgccgatcatggttgctcctactgccttt
caaaagatggctcaccctgatggggaatatgctacggctagagctgcgtctgctgctgga
accatcatgacactatcttcatgggctacttcaagtgttgaagaagttgcttccacaggg
ccaggaatccgattcttccagctctatgtatacaagaacaggaaggtggttgagcagctc
gtgagaagagccgagaaagctgggttcaaagccattgctctcactgtagacaccccaagg
ctaggtcgcagagagtctgatatcaagaacagattcactttgcctccaaacctgacattg
aagaactttgaaggtcttgaccttggaaagatggacgaggccaatgactctggcttggct
tcgtatgttgctggtcaaattgaccgtaccttgagctggaaggatatccagtggctccaa
acaatcaccaacatgccaattcttgtcaagggtgttcttacaggagaggatgcaaggata
gcgattcaagctggagcagcagggatcattgtgtcaaatcatggagctcgccagcttgat
tatgtcccagcaacaatctcagcccttgaagaggttgtcaaagcaacacaaggacgagtt
cctgtcttcttggatggtggtgttcgacgtggcactgatgtcttcaaggcacttgcactt
ggagcctctggaatatttattggaagaccagtggtttttgcactagctgctgaaggagaa
gccggagtcaaaaaggtgcttcaaatgttgcgtgatgagttcgagctaaccatggcacta
agtgggtgccggtcactcagtgaaatcacccgtaaccacattgtcacggaatgggacact
ccacgccatttgcccaggttatag

KEGG   Arabidopsis thaliana (thale cress): AT3G14420
Entry
AT3G14420         CDS       T00041                                 
Symbol
GOX1
Name
(RefSeq) Aldolase-type TIM barrel family protein
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath04146  Peroxisome
Module
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT3G14420 (GOX1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G14420 (GOX1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     AT3G14420 (GOX1)
SSDB
Motif
Pfam: FMN_dh IMPDH NMO DHO_dh ThiG DUF561 Glu_synthase His_biosynth PA
Other DBs
NCBI-GeneID: 820665
NCBI-ProteinID: NP_188060
TAIR: AT3G14420
UniProt: Q9LRR9 A0A654FH32
LinkDB
Position
3:4821391..4824178
AA seq 367 aa
MEITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDM
TTTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTG
PGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTL
KNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDARI
AIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALAL
GASGIFIGRPVVFSLAAEGEAGVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWDT
PRPSARL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggagatcactaacgttaccgagtatgatgcaatcgcaaagcagaagctgcctaagatg
gtgtacgactactatgcatctggtgcagaagaccaatggactcttcaagagaacagaaac
gcttttgcaaggatcctctttcggcctcggattctgattgatgtgagcaagattgacatg
acaaccaccgtcttggggttcaagatctcgatgcccatcatggttgctccaactgccatg
caaaagatggctcaccctgatggggaatatgctactgctagagctgcatctgcagctgga
actatcatgacactatcttcatgggctacttccagcgttgaagaagttgcgtctacaggg
ccagggatccgattcttccagctctatgtatacaagaacaggaatgtggttgagcagctc
gtgagaagagctgagagggctgggttcaaagccattgctctcactgtagacaccccaagg
ctaggccgcagagagtctgatatcaagaacagattcactttgcctccaaacctgacattg
aagaactttgaaggacttgacctcggaaagatggacgaggccaatgactctggcttggct
tcatatgttgctggtcaaattgaccgtaccttaagctggaaggatgtccagtggctccag
acaatcaccaagttgcccattcttgtcaaaggtgttcttacaggagaggatgcaaggata
gcgattcaagctggtgcagccggaatcattgtatcaaaccatggagctcgccagcttgac
tatgtcccagcaaccatctcggcccttgaagaggttgtcaaagcgacacaaggacgaatt
cctgtcttcttggatggtggtgttcgacgtggcactgatgtcttcaaagcacttgcactt
ggagcctccgggatatttattggaagaccagtggtattctcattggcagctgaaggagag
gctggagttagaaaggtgcttcaaatgctacgtgatgagttcgagctgaccatggcactg
agtgggtgtcggtccctaaaggaaatctcccgtaaccacattaccaccgaatgggacact
ccacgtccttcagccaggttatag

KEGG   Arabidopsis thaliana (thale cress): AT4G18360
Entry
AT4G18360         CDS       T00041                                 
Symbol
GOX3
Name
(RefSeq) Aldolase-type TIM barrel family protein
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath04146  Peroxisome
Module
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT4G18360 (GOX3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G18360 (GOX3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     AT4G18360 (GOX3)
SSDB
Motif
Pfam: FMN_dh NMO IMPDH ThiG Glu_synthase TMP-TENI His_biosynth DUF561 DHO_dh PA
Other DBs
NCBI-GeneID: 827563
NCBI-ProteinID: NP_001329914
TAIR: AT4G18360
UniProt: O49506
LinkDB
Position
4:complement(10145895..10148764)
AA seq 368 aa
MEITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDV
STTVLGFNISMPIMIAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATCSVEEVASTG
PGIRFFQLYVYKDRNVVIQLVKRAEEAGFKAIALTVDTPRLGRRESDIKNRFALPRGLTL
KNFEGLDLGKIDKTNDSGLASYVAGQVDQSLSWKDIKWLQSITSLPILVKGVITAEDARI
AVEYGAAGIIVSNHGARQLDYVPATIVALEEVVKAVEGRIPVFLDGGVRRGTDVFKALAL
GASGVFVGRPSLFSLAADGEAGVRKMLQMLRDEFELTMALSGCRSLREISRTHIKTDWDT
PHYLSAKL
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggagataacaaacgtgatggaatatgagaagatcgcaaaggagaaattaccaaagatg
gtttatgattactatgcatctggtgctgaagatcaatggactcttcaagagaatcgaaac
gctttctctaggattctatttaggcctcggattcttatcgatgtaagcaagattgatgtg
agcacaacggttttagggtttaatatttctatgccaattatgattgctcctactgcaatg
cagaaaatggctcatcctgatggcgagcttgcaaccgcgagagctacttctgctgctgga
acaatcatgactttatcttcatgggctacttgtagtgttgaggaagttgcttcaaccgga
ccagggattcgttttttccaactttatgtttataaggatagaaatgtggttatacagctt
gtgaaacgagctgaagaagctggattcaaagctattgctcttactgtagatactccaagg
cttggacgcagagaatctgacatcaaaaacagattcgcgcttcctcgaggtctaacgttg
aagaacttcgaagggttggatcttgggaaaatagacaagacgaatgactcagggctagct
tcatatgttgctggtcaagttgatcaatcacttagctggaaggatataaaatggctccaa
tctatcacaagcttgccaattcttgtcaagggtgttattacagctgaggatgcaagaatt
gctgttgaatatggagctgcagggataatagtctctaaccacggagctcgtcagctagat
tatgttcctgcaactatagtggccttagaagaggtggttaaagccgtggagggtcggatt
ccggtttttcttgacggtggggttcgccgtggaaccgatgtctttaaggcattggctctt
ggcgcttcaggtgtctttgtcgggaggccgagcttgttctcgcttgcagcggatggagaa
gcgggagttaggaagatgctacaaatgctaagagacgagtttgagcttacaatggcacta
agtggttgccgttcactgagagagatcagccgaacccacatcaagactgattgggacact
cctcattacctctcggccaagctgtag

DBGET integrated database retrieval system