KEGG   Arabidopsis thaliana (thale cress): AT3G17609
Entry
AT3G17609         CDS       T00041                                 
Symbol
HYH
Name
(RefSeq) HY5-homolog
  KO
K16241  transcription factor HY5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT3G17609 (HYH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT3G17609 (HYH)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   Plant bZIP factors
    AT3G17609 (HYH)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 CENP-F_leu_zip Phlebovirus_NSM Nnf1 DivIC bZIP_Maf Macoilin Cep57_CLD_2 DUF724
Other DBs
NCBI-GeneID: 821027
NCBI-ProteinID: NP_850605
TAIR: AT3G17609
UniProt: Q8W191 A0A178VIU6
Structure
LinkDB
Position
3:6023844..6024710
AA seq 149 aa
MSLQRPNGNSSSSSSHKKHKTEESDEELLMVPDMEAAGSTCVLSSSADDGVNNPELDQTQ
NGVSTAKRRRGRNPVDKEYRSLKRLLRNRVSAQQARERKKVYVSDLESRANELQNNNDQL
EEKISTLTNENTMLRKMLINTRPKTDDNH
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtctctccaacgacccaatgggaactcgagttcgtcttcttcccacaagaagcacaaa
actgaggaaagtgatgaggagttgttgatggttcctgacatggaagcagctggatcaaca
tgtgttctaagcagcagcgccgacgatggagtcaacaatccggagcttgaccagactcaa
aatggagtctctacagctaaacgccgccgtggaagaaaccctgttgataaagaatataga
agcctcaagagattattgaggaacagagtatcagcgcaacaagcaagagagaggaagaaa
gtgtatgtgagtgatttggaatcaagagctaatgagttacagaacaacaatgaccagctc
gaagagaagatttctactttgacgaacgagaacacaatgcttcgtaaaatgcttattaac
acaaggcctaaaactgatgacaatcactaa

KEGG   Arabidopsis thaliana (thale cress): AT5G11260
Entry
AT5G11260         CDS       T00041                                 
Symbol
HY5
Name
(RefSeq) Basic-leucine zipper (bZIP) transcription factor family protein
  KO
K16241  transcription factor HY5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G11260 (HY5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT5G11260 (HY5)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   Plant bZIP factors
    AT5G11260 (HY5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 Lebercilin Phlebovirus_NSM GAS bZIP_Maf Gal4_dimer FlaC_arch NBP1 TSC22 Fmp27_WPPW Aminopep Nnf1 DUF3563 SHE3 Herpes_BLRF2 HlyD_2 V_ATPase_I DMPK_coil ATG14 DUF724 Pneumo_att_G Uso1_p115_C UPF0242 EMP24_GP25L MIC19_MIC25
Other DBs
NCBI-GeneID: 830996
NCBI-ProteinID: NP_568246
TAIR: AT5G11260
UniProt: O24646 A0A384KAH1 Q1H5E5
Structure
LinkDB
Position
5:complement(3593335..3595073)
AA seq 168 aa
MQEQATSSLAASSLPSSSERSSSSAPHLEIKEGIESDEEIRRVPEFGGEAVGKETSGRES
GSATGQERTQATVGESQRKRGRTPAEKENKRLKRLLRNRVSAQQARERKKAYLSELENRV
KDLENKNSELEERLSTLQNENQMLRHILKNTTGNKRGGGGGSNADASL
NT seq 507 nt   +upstreamnt  +downstreamnt
atgcaggaacaagcgactagctctttagctgcaagctctttaccatcaagcagcgagagg
tcatcaagctctgctccacatttggagatcaaagaaggaattgaaagcgatgaggagata
cggcgagtgccggagtttggaggagaagctgtcggaaaagaaacttccggtagagaatct
ggatcggcgaccggtcaggagcggacacaggcgactgtcggagaaagtcaaaggaagcga
gggaggacaccggcggagaaagagaacaagcggctgaagaggttgttgaggaacagagtt
tcagctcagcaagcaagagagaggaaaaaggcttacttgagcgagttggaaaacagagtg
aaagacttggagaacaaaaactctgaacttgaagagcgactctctactcttcagaacgag
aaccagatgcttagacatattctgaagaacacaacaggaaacaagagaggaggtggtggt
ggttctaatgctgatgcaagcctttga

DBGET integrated database retrieval system