KEGG   Arabidopsis thaliana (thale cress): AT3G18770
Entry
AT3G18770         CDS       T00041                                 
Name
(RefSeq) Autophagy-related protein 13
  KO
K08331  autophagy-related protein 13
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G18770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G18770
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G18770
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    AT3G18770
   Atg1 complex
    AT3G18770
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    AT3G18770
SSDB
Motif
Pfam: ATG13
Other DBs
NCBI-GeneID: 821408
NCBI-ProteinID: NP_188507
TAIR: AT3G18770
UniProt: F4J8V5 A0A178VAK8
LinkDB
Position
3:complement(6459816..6463101)
AA seq 625 aa
MSSSHNRSNNNNSEGAKAEQIIFEFFAKSLHIILESRTPFMSSRNFSGEQMICSPSSSSS
SSSSVRPRDKWFNLALRECPAALESFDIGRRSSLEPLVVDVVLVVRPLVGDQSGKRELIR
NFSGKDYQSGWNSDQDELGCETKNEQIIERWVVQYDNRKIRESVTTSSRRSSSNKLQVMY
KKATLLLRSLFVMVRLLPAYKIFRELNSSGQIFKFKLVPRVPSIVEPFTRKEEAEMQKFS
FTPVETICGRLCLSVLYRSLSDVSCEHSTPMSPTFITDYVGSPLADPLKRFPSLPLSYGS
PPLLPFQRRHSWSFDRYKASPPSVSCSPSPTRSDSHALVSHPCSRHLPPHPSDIPTGRRK
ESYPEEYSPCQDFSPPPSPSAPKHAVPRGITRTESAPVRIPAPTFQSKENVVAPSAHLKL
SRHASLKPVRNLGPGESGAAIDKLFLYGRDDFRRPSGVRPSSSSSPRISFSRSSSRSFQD
DFDDPDFPCPFDVEYDDITDRNSRPGSFDHRGDIHEPFDSSGSYPKKSQDAAVGALVRML
KKAPPLRQDVSESSRPEICSNNNKPAGAHEIAVASITASGIALASKTTADALEELRSYKE
MKNHLLLGQSTSNPSSVTITSPFDV
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgtcatcttcacacaacaggagtaacaacaacaattcagaaggagctaaagcagaacag
atcatatttgagttctttgctaaaagccttcacatcattctcgaatcaaggactcctttt
atgtcttcaaggaactttagtggtgagcagatgatttgttctccttcctcatcttcttcc
tcttcctcgagtgttagacctcgagacaaatggttcaatctagctcttagggaatgtcct
gcagctttagagagtttcgatatcgggcggagaagcagtcttgagcctttggttgttgat
gttgttcttgtggtgaggccacttgttggtgatcagtctggtaaaagggagcttatcagg
aacttctccgggaaagattatcagtctggttggaattctgatcaagatgaattgggatgt
gagactaagaacgagcagattattgagagatgggtggtgcaatatgataataggaagatc
agggaatctgttactactagtagcaggaggtcaagcagtaataagttgcaagtgatgtat
aagaaagctactctgctgcttagatcattgtttgtcatggttaggcttttacctgcttat
aagatttttcgggaactcaattcctcggggcagatcttcaagttcaagcttgttcctagg
gtcccttctatagttgagccattcactcgtaaagaagaagcagaaatgcagaagttttct
ttcacaccggttgaaacgatctgtggtagactttgcttatcggttttatatcgttctctc
tcagatgtcagttgcgaacactctacacctatgtctccaacatttataaccgattatgtt
ggaagtcccttggctgatcctttaaagaggttcccttcccttcctctttcatatggttct
cctccattgctgccatttcaaaggcgccatagctggagtttcgatcgttacaaggcatct
ccaccttctgtttcttgctcaccatcgcctacacgctcggattcacatgcattggtttca
catccttgctctcgtcatcttcctcctcacccttctgatatacccactggtcgtaggaag
gaaagctaccccgaagagtattctccttgtcaagatttctcccctcctccttctccttca
gcaccaaaacacgccgtcccaagaggcatcacacgtactgaaagtgctccagtcagaata
ccagctccaactttccagtccaaagaaaacgttgtggcaccttctgctcatctgaagttg
tcgagacacgcttcgttgaagcctgtgagaaacttgggtcctggtgaatctggagcagca
atagataagctgtttctttatgggagagatgactttagaagaccttctggggtgaggccg
tcttccagcagttctccgcggatatcattttcccggagttccagtagatctttccaagac
gattttgatgatcctgatttcccttgcccatttgatgttgagtatgatgatattacagat
cggaatagcagaccagggtcgtttgaccacagaggagacatacatgaaccattcgattca
agcgggtcatacccgaagaagtcccaagatgctgcagttggtgcccttgtgagaatgctg
aagaaagcgccacctctcagacaagatgtctctgaatcttccagacctgaaatttgctcg
aacaacaacaaacccgcaggggctcatgagatagcagtagcgtctatcacagcctcgggg
attgctctggcctcaaagacaacagctgatgctttggaagagttgaggtcttacaaagaa
atgaagaatcatttgttgcttggtcaatccacatcaaacccttcctcggttactattact
tcaccctttgatgtttga

KEGG   Arabidopsis thaliana (thale cress): AT3G49590
Entry
AT3G49590         CDS       T00041                                 
Symbol
ATG13
Name
(RefSeq) Autophagy-related protein 13
  KO
K08331  autophagy-related protein 13
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G49590 (ATG13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G49590 (ATG13)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G49590 (ATG13)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    AT3G49590 (ATG13)
   Atg1 complex
    AT3G49590 (ATG13)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    AT3G49590 (ATG13)
SSDB
Motif
Pfam: ATG13 S6OS1
Other DBs
NCBI-GeneID: 824121
NCBI-ProteinID: NP_190528
TAIR: AT3G49590
UniProt: Q9SCK0
LinkDB
Position
3:18377409..18380369
AA seq 603 aa
MDFPENLPSDIGRLEQIVSHFFPKALHIVLNSRIPSLQSRGRTRERLSGLNVRKSDKWFN
LVMGDRPAALEKLHSWHRNILDSMIIDIILVHPISNDNLDDDDDHSDSVVRSAETVIERW
VVQYENPLIMSPQSSDSATRYQKVYKKSIILLRSLYAQTRLLPAYRVSRQLSSSLASSGY
DLIYKVSSFSDIFSGPVTETMKEFRFAPVEVPPGRLCASVTYRSDLSDFNLGAHITLPPR
IITDYVGSPATDPMRFFPSPGRSVEGHSFTGRAGRPPLTGSSAERPHSWTSGFHRPPAQF
ATPNQSFSPAQSHQLSPGLHDFHWSRTDAFGDNHQLSPPFSPSGSPSTPRYISGGNSPRI
NVRPGTAPVTIPSSATLNRYVSSNFSEPGRNPLPPFSPKSTRRSPSSQDSLPGIALYRSS
RSGESPSGLMNQYPTQKLSKDSKYDSGRFSGVLSSSDSPRFAFSRSPSRLSSQDDLDDPD
CSCPFDFDDVDESGLQYSHSLDRRKTSSSISQSLPLGRRSSQDAAVGVLVHMLKTAPPLR
QDSSTYMASMSGVQREGSVSGTESEFSMARSTSDALEELRNYKQLKDLLLSKSKSGSGPT
RVH
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggattttccagagaatttgccttcagatataggaagattagagcagattgtttctcat
ttcttcccaaaagcattacacatagttcttaattccagaatcccttcgttgcaatctcgt
ggtcgtactcgtgagcgtttatcaggtcttaacgttagaaaaagtgacaaatggtttaat
cttgtgatgggagatcgtcctgctgcgttggagaaattgcattcttggcataggaatatt
ctggattctatgattattgatatcattcttgtccatccgatttcaaacgataatttggat
gatgatgatgatcatagtgattctgttgttagatcagctgagactgtgattgagcgttgg
gttgttcaatatgagaatcctttgattatgtctcctcagagttctgactctgcaacgcgt
taccagaaggtttacaagaaatctatcattctgttgcggtctctttatgcacagactcgg
cttcttcctgcttatcgtgtctctaggcagctgagttcttctcttgcttcttctggttat
gatttgatttacaaggtttcatctttcagtgacatattctctggtcctgtgacggaaaca
atgaaagagtttcgttttgctcctgttgaagtgcctcctggtcgtctttgtgcatcggtt
acttaccgttctgacttatctgattttaatctcggtgctcatatcacattgcctccgagg
attataactgattatgtgggaagtcctgcaacagatcctatgaggtttttcccttctcca
gggagaagtgttgaaggccattcctttactggtagagctggtcggcctccattgactggt
tcatctgcagaacgtccgcatagctggactagcggctttcacagacctccagctcaattc
gcaacaccgaaccaatctttttcgccagctcagtctcatcagttgtcacctgggttacac
gatttccactggtcacgtacagatgcttttggtgacaatcaccagctttcacctcccttt
tcaccatcgggttctccatctactccaagatacatatctgggggtaacagtccgcgcatt
aatgtgagaccagggactgctccagtgaccattccttcttcagccacgttaaatagatac
gtttcatctaacttctctgagccaggtaggaatccacttcctcctttttcccccaaaagc
acaagacgctccccttcatcgcaggactctttgcctgggattgcgttgtacaggagttct
agaagcggagagtctccttctggattaatgaaccagtaccctactcaaaagctgtcaaag
gacagcaaatacgattcaggccgcttctcaggagttctgtcttcgagtgactcaccaaga
ttcgcgttttctaggagccccagtagattatcttcccaagacgacttggatgaccctgat
tgttcatgcccttttgatttcgatgatgttgatgagtcaggacttcagtacagccatagt
cttgaccggaggaaaacttcaagctctatatcgcagtcgctacctctagggagaagatca
tcacaggacgcagcggttggtgttctggttcacatgctgaagacagcaccaccattacga
caagactcaagcacttatatggcgtcaatgtctggggttcagagagaaggttcagtgtca
ggtacagaatctgaattttcgatggctcgtagcacatcagatgcactagaggaactgaga
aactacaaacagctcaaagacttgcttctctccaaatccaaaagtgggtctggaccaact
cgcgtccactga

DBGET integrated database retrieval system