KEGG   Arabidopsis thaliana (thale cress): AT3G19190
Entry
AT3G19190         CDS       T00041                                 
Symbol
ATG2
Name
(RefSeq) autophagy 2
  KO
K17906  autophagy-related protein 2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G19190 (ATG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G19190 (ATG2)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G19190 (ATG2)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    AT3G19190 (ATG2)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT3G19190 (ATG2)
SSDB
Motif
Pfam: ATG_C Chorein_N ATG2_CAD
Other DBs
NCBI-GeneID: 821453
NCBI-ProteinID: NP_001327751
TAIR: AT3G19190
UniProt: F8S296
LinkDB
Position
3:6639639..6648870
AA seq 1892 aa
MVFPWNIAKSAEEAFSRWAVKRVVKFLLKKKLGKLILGDIDLDQLDIQLRDGTIQLSDLA
INVDYLNDKFDAPLVIKEGSIGSLLVKMPWKTNGCQVEVDELELVLAPRLESNKSSSNEA
STSASTREDLHNIRLEIGKHENEMLMNAAKSASIDVHEGVKTVAKIVKWFLTSFHVKIKN
LIIAFDPDFGKKQSEAGPRPTLVLRMTEIECGISEEQVSANEVSPDNFLGINRLANCVKF
QGAVVELLNMDDDDDGDKTCDKKTSNDVTLIMTGVGGGFSGSLNFSIPWKNGSLDIRKVD
ADISIDPVEVRFQPSTIRWFLQLWKTFTSFGSDCFPSVSHSDFLTDSPTIPTNVMVTPPA
TLSLSGGQELEHDTTPNLQFIPDWFPSSFSKKEEDGEVDIGASVDQFFECFDAMRSYQSA
SGSQGMWNWTSSVFTAINAASSLASGSLLLPSEQQHVETSCKVSFAGVSVVLFFQDEVNW
KGVSTRIHYLGAELRDISVSFQVCLHDLRLEGEVNSMEIADYCQGGNVVDTANAESQTCL
IKDLQAKVQTSLPPFASSDMHSDSERLSEIVSDGFLFRNKGFAVKTLLVIAAGGSGFQFT
VNFQSSKASHRGSNSFSLSLPPTTFWLNLHSVEMLVNLFNDVSESIPITSHERNQVASSS
KSESLRGSVSICNARVILWFPFESISERFCNSLGQQFIVVDLSSSPPSDKERAKERSPGE
MHFPSATRSICFSVGDASIYLVTSDLKDSETNSYHRQVEFSAYNILHTNNKTRHQLSTIG
MFWQDRPTVSPWLVERAKMLATQEESIQTDKSGGRGLEFAAVATPKDQDDIYSRSRKEII
LASSFCLYVHLLPLAIHLDSWQYSKLCNLIEEAKNWLSRMAANTAEQTEESVVCQTSLVV
DCDSIDILVRPEPRMGIKKQLQTELPGSWIQFNLRVQKLNLMSVPNLGSVSGADFFWLAH
GEGTLLGSVTGLPDQELLLLSCNNSAIKRGNGGGSNALSSRFAGLDFLHLQEPGICNDYL
AVSARGCTISAVGGRLDWIEVATSFFSFEDEKKTQEINSSSSSGSSFILNFVDVGLSYEP
HHENTDHLRQASDPWVACLVAASSFSLSKKSLVDSIRNDYRIRIQDLGLLLSVDFDLSKL
GGTYSSEHLHESGYVKVANDSLIEAILRTNSENGLLWELECSKSHLVIETCSDTTSGLIR
LATQLQQLLAPDLEESAVHLQTRWDSIQQANARNDLDISDRLSSSDSSGEMKYLRLESEN
ETGVIGLMDEINEDAFQFDVNPTYQSDSVECQNNYMSPHGISHGQAYNWVPATEKLPSNQ
SICGSSSRINSESSQVFLERESLPEIFENYCLSEFRPSSEVPQEGDSSGRELFPETDLRR
GNSGWYDDASLRIVEDHVSEATEEDHEEHILDGECSSFGQTSYSAVAANGRILLKNIDLK
WRIYSGSDWHDSRKKGENFKHTKGRDTTSCLELELSGVQFLYETFPIGEICTSKLSLMVQ
DFYLYDRSDNAPWTLVLGYYNSKDHPRDSSSYAFKLELKAVRPDPETPLEENRLRVALLP
ILLHLHQSQLDFLISFFGANSLEKPVVSMGDSGGSTMSVSVQGHNIIEEALLPYFQKFDI
WPVNVRVDYSPHHVDIAALTGGKYAELVNLVPWKGIELQLKHVHAAGIYGWGNVCETILG
EWLEDVSQNQIHQLLKGIPTVRSLSALYAAALKLVSSPVESYRKDRRLVKGVQRGTVAFL
RSISLEAVGLGVHLAAGAHDILLRAEYIFASSPSLPQPQGRTKTNVRHNQPRNAKQGMLK
ACESIGDGIGKTASALVRTPLKKYQRGDGAGSAFATVVQGVPTAAIAPASACARAVHSAL
VGIRNSLDPEHKKESMEKYLGPDKQRKQDQHR
NT seq 5679 nt   +upstreamnt  +downstreamnt
atggtgtttccgtggaacattgctaaatcagcggaggaagctttttctagatgggcggtg
aagagggttgtcaaattcctgttgaagaagaaattgggtaaactcatacttggtgatatc
gaccttgatcagctcgatattcagcttcgtgatggcactattcagctctccgatcttgct
atcaacgttgactatttgaatgacaagtttgatgctccactcgtcataaaagaaggctca
attggatctttgttagttaaaatgccttggaagaccaatggttgtcaagttgaggttgac
gagctggagcttgttcttgcaccacgtttggagagtaataaatcatcttcaaatgaagcc
agcacctccgcctctacacgagaagatttacataatatacgtcttgaaataggaaagcat
gagaatgagatgttgatgaatgctgcaaaatctgcgtctatcgatgtccatgaaggtgtt
aagacggttgccaagatagtgaaatggtttcttactagttttcacgtcaaaattaagaat
ctgattatagcatttgatcccgattttggcaaaaaacagtctgaagctggtcctcgacca
acattggtacttagaatgacagaaatagagtgtggaatttcagaggagcaagtttcggct
aatgaagtttctcctgataatttccttggtattaatcgacttgcaaactgtgtgaagttt
caaggagccgttgtagagcttttaaatatggatgatgatgatgatggcgacaaaacttgt
gataaaaagacatcaaatgatgtgactttgatcatgacaggcgtaggaggtggcttttca
gggagtttaaattttagtataccctggaagaatggttctttagacattcgcaaggtggat
gctgatatttctattgatcctgttgaagtacgatttcaaccgtctacaattagatggttc
ttacaattgtggaagacgttcacaagttttggatcagactgtttcccctcagtttctcat
tctgattttttgacggattcacctacaatacctactaatgtaatggtaacgcctccagct
acactatccttgtcaggtggccaagaattggagcatgatactacacctaacttacagttt
ataccggattggtttccgtcttcgttcagcaagaaagaagaggatggagaagtagatatt
ggggcaagtgtggaccagttttttgaatgttttgatgcaatgaggagttaccaatcagct
tctggaagccaaggaatgtggaattggacatcttctgttttcacagcaataaatgctgca
tctagccttgcttcggggtctttgcttcttccttctgaacaacaacatgttgaaacaagt
tgtaaagtatcctttgctggagtttcggtggtattatttttccaagatgaagtcaattgg
aagggtgtttcaacgcggattcactacttgggtgccgaactcagagatatttcggtctct
tttcaggtatgccttcatgatctgaggttagaaggagaagtgaacagcatggagatcgcc
gattattgtcaaggtggaaatgttgttgacactgctaatgctgaatctcagacttgtttg
attaaggatttacaagccaaagttcagactagtcttcctccctttgcctcttctgatatg
cattctgactctgaaagattaagcgagatagtttctgatggattcctctttcgtaacaag
ggtttcgcagtcaagacattgttggttatagctgcagggggcagtggatttcagtttact
gtcaatttccaatcatccaaagccagccatagaggatcaaactcattctcattgagttta
ccccctaccacattctggctgaaccttcattcggtagaaatgttggtaaatcttttcaac
gatgtatcagaatctatccccataaccagtcatgaaaggaatcaggtggcatcctcttct
aaatcagaaagtttgcgaggtagtgtgtcaatctgcaatgctcgagtgattctgtggttt
ccttttgagagcatttcagaaaggttctgcaactcgcttggtcagcaatttatcgtcgtc
gatctatcttcctctccgccatctgataaggaaagggctaaggaaagaagtccaggagaa
atgcactttccatcagctactcgctctatatgcttcagtgttggtgatgctagcatctat
ttggtcacttctgaccttaaagattctgaaacaaattcatatcataggcaggttgaattc
tctgcgtataatattttacataccaacaataaaactaggcaccaactttcaacaattggc
atgttttggcaagatagacctaccgttagcccttggttagtggagagagctaagatgttg
gctacgcaggaagaatctattcagacagataaatctggcgggaggggccttgagtttgct
gctgttgctacgcccaaagatcaagacgacatctactctcgaagcaggaaagaaataatt
ttggcttcttcgttctgcctttatgttcatttgcttccacttgctatccatttagatagt
tggcaatacagcaaattatgtaatctaatagaagaggcaaaaaattggctatcgcgtatg
gcagccaatacagctgagcaaacagaggaatctgttgtgtgtcaaacgtctctcgttgtt
gactgtgattctattgacatattggttaggccagaacctcgaatgggcataaaaaaacag
cttcagactgagctccctggatcatggattcagttcaacctgagggttcagaaattaaat
cttatgtctgtcccaaatcttggcagtgtctctggtgctgatttcttttggttagcccat
ggggaaggtacattattgggttctgttacaggtctacctgatcaggaactgttattactc
tcatgtaacaactctgccatcaagcgtggtaatggaggaggttcaaatgcgttgtcgtca
aggttcgctggcttagattttctgcacttacaggaaccaggaatttgtaacgattattta
gcagtatctgccaggggctgtacgatctcggccgtaggaggacgcctggattggatagaa
gtggctacttcttttttctcttttgaagatgaaaaaaaaactcaagagatcaactccagc
tcatctagcggctcctcgtttattctgaattttgttgatgttggtctaagctatgagccc
caccatgagaatacagatcatttacgtcaagcaagtgatccatgggttgcctgtctggta
gctgcatcttcttttagcctttcaaagaaaagtctggttgattccataagaaatgattat
agaatcaggattcaagatcttgggcttcttctgtccgtggattttgaccttagcaagctt
ggtggaacgtacagttcagagcatcttcatgagtctggctatgttaaagttgctaatgat
tcgcttattgaagcaattctaaggactaactctgaaaatggccttctttgggagttagag
tgttcaaaatctcacttagtaattgaaacttgcagtgacacgacttctggtttgattcgc
ttggccacccagctccaacagttacttgctcctgatttggaggaatcagctgtgcacttg
cagactcgatgggacagcattcaacaggcaaatgctaggaatgatttagatatcagcgat
agactcagtagctccgattcaagtggagaaatgaaatatttaagattagagtcagaaaat
gaaactggggtcattggtttgatggacgaaataaatgaagatgcattccaatttgatgtc
aatccgacatatcagtctgactctgtggaatgtcagaataactatatgtcacctcatgga
atctctcatgggcaggcatataattgggtaccagctactgagaaactaccttctaatcaa
agtatttgtgggtcgtcatccagaataaactcagaaagcagtcaagtattcctagaaaga
gagagcctgcctgaaatatttgaaaactattgtttgtctgagttccgtccatcgtcagag
gtacctcaagaaggggattcgtcggggagagaattgtttcctgagactgatctgaggaga
ggaaattctgggtggtatgatgacgcgtccttaagaattgtagaagaccatgtgtcagaa
gcaactgaggaagatcatgaggaacacattctggatggagaatgttcatcttttggccag
acgtcttattctgctgtagcagctaatggacgtatccttctgaaaaacattgacctcaaa
tggagaatttactctggctctgactggcatgattctagaaagaaaggtgaaaattttaaa
catacaaagggccgggatacaacttcgtgccttgagctggaattatctggggtgcagttc
ctgtatgaaacctttccaattggcgaaatatgtacctctaaattatctctcatggtccaa
gatttttatctttatgatagaagcgacaatgcaccttggacattggtccttggatattac
aactcaaaagatcacccaagagactcctcttcgtatgcattcaagttggaattaaaagct
gtcagacctgaccctgagacgccactcgaggaaaaccggttacgggtcgctttactccct
atactgttacatcttcatcaaagtcagctggattttctcatcagcttctttggagctaac
agcctagaaaagcctgttgtttctatgggagactcaggtggttcaacgatgtcggtttcc
gtacaaggacataatatcatagaagaagcgcttcttccatattttcagaaattcgacata
tggcctgttaatgttcgagttgattacagtccccatcatgttgatatagcagcactaaca
ggagggaaatatgcagagcttgtgaaccttgtaccctggaaggggattgaattacaactc
aaacatgtgcatgctgctggaatctatggctggggaaatgtatgtgagactatactggga
gaatggttggaagatgtatctcagaatcagattcatcaacttttaaaggggatcccaaca
gtaagatcactttctgctctttatgctgctgctctaaagctggtctcgtcacctgttgaa
agttacaggaaagatcgaaggctagtgaagggagtccaaagagggactgtagcgtttctc
agaagtatctcactggaagctgttggactcggtgttcacttggcagccggggctcatgat
attttattgagagcagaatatatatttgcaagttcaccatcattgccacaaccccaaggc
agaacgaagacgaatgtcagacataatcagcctagaaatgctaagcaaggcatgcttaag
gcatgtgagagcatcggtgatggaataggaaagacagcttctgcattagtccgcacacct
ttgaagaagtatcaacgtggagacggagctggatcagcatttgcaactgttgttcaggga
gttccaacagctgctatagcacctgcttcagcttgtgctagagctgtacatagtgctctt
gttggcatcagaaatagtcttgatcctgaacataaaaaggaatccatggaaaaatactta
ggccccgacaaacaaaggaagcaggaccaacaccgataa

DBGET integrated database retrieval system