KEGG   Arabidopsis thaliana (thale cress): AT3G61710
Entry
AT3G61710         CDS       T00041                                 
Symbol
ATG6
Name
(RefSeq) AUTOPHAGY 6
  KO
K08334  beclin
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G61710 (ATG6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G61710 (ATG6)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G61710 (ATG6)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    AT3G61710 (ATG6)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT3G61710 (ATG6)
SSDB
Motif
Pfam: APG6 APG6_N ERM_helical BIG2_C
Other DBs
NCBI-GeneID: 825344
NCBI-ProteinID: NP_567116
TAIR: AT3G61710
UniProt: Q9M367 A0A654FJW7
LinkDB
Position
3:complement(22839232..22842446)
AA seq 517 aa
MRKEEIPDKSRTIPIDPNLPKWVCQNCHHSLTIVGVDSYAGKFFNDPPPSATQGSSIHGA
NSVLGSTRMDNSFVVLPRHKPPQSQGIPPRPRGASSPQPDATQSGKAMEESFVVVYKSEP
VSDSGGSHNLSLEVGQNGPLHSNTSGFNATINVLTRAFDIARTQTQVEQPLCLECMRVLS
DKLEKEVEDVTRDVEAYEACVQRLEGETQDVLSEADFLKEKKKIEEEERKLVAAIEETEK
QNAEVNHQLKELEFKGNRFNELEDRYWQEFNNFQFQLIAHQEERDAILAKIEVSQAHLEL
LNKTNVLIDAFPIRNDGEFGTINNFRLGRLPAIKVEWDEINAAWGQACLLLHTMCNYFRP
KFQCQVKIQPMGSYPRIVDSNNETYELFGPVNLFWSTRYDKAMTLYLMCLKDFADFANSK
DQENNIPPDNCLNLPYKIEKDKVLGYSITQSFNKQESWTKALKYTLCNLKWALYWFVGNT
NFQPLSATVSLPSNISAAGSLYAKRGPDSSKPSCKKT
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgaggaaagaggagattccagataaaagtcggactatcccgatcgatccgaatctgccg
aaatgggtctgccaaaactgtcaccactcccttaccatcgtcggcgtcgattcctacgcc
ggcaagttcttcaacgatccccctccgtccgctacgcagggctcatctatccatggagct
aacagtgttcttggttcaacacgcatggacaactcttttgttgttttacctcgacataag
cctcctcaatctcagggcattcctccacgtcctcgcggggcgtcctcacctcagcctgat
gctactcaatctggaaaggcgatggaggaatcgtttgtagttgtctataagtctgagcct
gtttctgattctggtggttctcacaatctgtctcttgaagtgggccaaaacggtccctta
cattcaaatacttctggctttaatgcgactatcaatgtcttaactcgtgcttttgatatt
gctagaactcagacacaggttgaacagccattgtgcttagaatgcatgagggtattgtct
gataaacttgaaaaagaagtcgaggatgtgacgagggacgtggaagcatacgaagcatgc
gttcagaggttagaaggagagacgcaagatgttcttagtgaagctgattttctcaaggaa
aagaagaagattgaggaagaagaaagaaaacttgttgcagctatagaagaaacagagaaa
caaaatgctgaagtaaaccatcaactgaaggagctagaattcaagggaaatcgttttaac
gaacttgaagatcggtattggcaagagttcaataattttcagtttcaattaattgcccat
caggaagagagagatgcaatcttggcaaagattgaagtttcacaagcacatttagagtta
ttaaataagacaaatgtacttattgatgccttccccatacggaatgatggggaatttggt
acaattaacaattttcgacttggaagactccctgccataaaagttgagtgggatgagatc
aatgctgcttggggccaagcctgtcttctcctccatacgatgtgtaactatttccggcca
aagtttcaatgtcaagttaaaatacagccgatggggagttatcctagaattgtagacagc
aacaacgaaacttatgagctgtttggtcctgttaacttgttttggagcactcggtacgat
aaagccatgacactgtatttgatgtgtcttaaagactttgctgattttgcaaattcaaag
gaccaagagaacaatattccaccagataattgcctcaaccttccatacaagatcgaaaag
gacaaagtattggggtattcaataacacagagcttcaacaagcaagagagttggaccaaa
gcactaaagtatactctctgcaacctcaaatgggctctctactggttcgttggaaacact
aatttccaacctctctctgcgacggtctctctgccttctaatatatcagcggctggttcc
ttgtacgccaagcgaggtcctgactctagtaagccttcatgtaaaaaaacttag

DBGET integrated database retrieval system