KEGG   Arabidopsis thaliana (thale cress): AT4G04470
Entry
AT4G04470         CDS       T00041                                 
Symbol
PMP22
Name
(RefSeq) Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein
  KO
K13347  peroxisomal membrane protein 2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G04470 (PMP22)
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 825777
NCBI-ProteinID: NP_001319865
TAIR: AT4G04470
UniProt: Q9ZS51 A0A384KA19 Q0WTY9
LinkDB
Position
4:complement(2227661..2230485)
AA seq 190 aa
MGSSPPKKTTLQRYLSQLQQHPLRTKAITAGVLSGVSDVVSQKLSGIQKIQLRRVLLKVI
FAGGFLGPAGHFFHTYLDKFFKGKKDTQTVAKKVILEQLTLSPLNHLLFMIYYGVVIERT
PWTLVRERIKKTYPTVQLTAWTFFPVVGWINYKYVPLHFRVILHSLVAFFWGIFLTLRAR
SMTLALAKAK
NT seq 573 nt   +upstreamnt  +downstreamnt
atgggatcttcaccaccgaagaagacgactctgcaacggtacttgtcacagcttcaacaa
catcctttaagaacaaaggcaataactgctggagttttgtctggtgttagcgatgttgta
tcacagaagctctctggcatacagaagattcagctgagaagggttcttctcaaagtgata
tttgctggtgggtttcttggaccagcagggcatttctttcatacatatttagataagttt
tttaaagggaagaaggatacacagactgttgcaaagaaggtaattctggagcaattgaca
ttgtcaccattgaaccatttgcttttcatgatctattatggagtagtcatagaaagaact
ccctggacccttgttagagaaaggatcaagaagacttatccaacggtccagcttactgca
tggacgtttttcccggtggtgggatggattaactacaagtatgtgccactgcacttccgg
gtcatcttgcacagcctggtcgcattcttttggggaattttcctaaccctgcgagcgagg
tcaatgacactagctttggcaaaggctaagtga

KEGG   Arabidopsis thaliana (thale cress): AT4G14305
Entry
AT4G14305         CDS       T00041                                 
Name
(RefSeq) Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein
  KO
K13347  peroxisomal membrane protein 2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G14305
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 3770487
NCBI-ProteinID: NP_001031637
TAIR: AT4G14305
UniProt: Q56WE5 A0A654FP65
LinkDB
Position
4:complement(8235093..8236744)
AA seq 185 aa
MSDLAKDAWRKYLIQLQAHPLRTKAITAGVLAGCSDAIAQKISGVKRIQFRRLLLLMLYG
FAYGGPFGHFFHKLMDTIFKGKKGNSTVAKKVLLEQLTSSPWNNFLFMSYYGLVVEGRPW
KLVKHKLGKDYPTIQLTAWKFWPIVGWVNYQYVPLQFRVLFSSFVASCWSIFLNLKARSP
VIKNA
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtcggatcttgctaaagacgcatggcgaaagtatctgattcagcttcaagctcatcct
ttacgaaccaaggcgatcactgcaggggttttagctggatgtagtgatgctatagctcag
aagatctctggagttaaacggattcagttccggagattgcttctccttatgttgtatggc
tttgcttatggaggaccatttggtcactttttccacaaattgatggataccattttcaaa
gggaagaagggtaattcaactgttgccaaaaaggttttgttggagcaacttacatcatct
ccttggaacaattttcttttcatgtcttactatggtttagtagttgaaggaaggccatgg
aagctagtgaagcacaaacttggaaaagattaccctactatccagttaaccgcatggaag
ttctggcctatcgtgggatgggttaattatcagtatgtgcctctccaattccgtgttttg
ttcagcagcttcgtcgcctcttgctggagcatatttctgaacttgaaagcgcgatctccg
gtgatcaaaaacgcgtag

DBGET integrated database retrieval system