KEGG   Arabidopsis thaliana (thale cress): AT5G08330
Entry
AT5G08330         CDS       T00041                                 
Symbol
TCP11
Name
(RefSeq) TCP family transcription factor
  KO
K16221  transcription factor TCP21 (protein CCA1 HIKING EXPEDITION)
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G08330 (TCP11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT5G08330 (TCP11)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Other transcription factors
   TCP
    AT5G08330 (TCP11)
SSDB
Motif
Pfam: TCP
Other DBs
NCBI-GeneID: 830730
NCBI-ProteinID: NP_196450
TAIR: AT5G08330
UniProt: Q9FTA2 A0A178UQG9
LinkDB
Position
5:2680401..2681993
AA seq 239 aa
MADNDGAVSNGIIVEQTSNKGPLNAVKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTR
ELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTASLSTSSPFTLGKRVVRAEEGES
GGGGGGGLTVGHTMGTSLMGGGGSGGFWAVPARPDFGQVWSFATGAPPEMVFAQQQQPAT
LFVRHQQQQQASAAAAAAMGEASAARVGNYLPGHHLNLLASLSGGANGSGRREDDHEPR
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccgacaacgacggagcagtgagtaacggcatcatagtcgagcagacgtcaaacaaa
ggacctcttaacgccgttaagaaaccaccgtctaaagatcgacacagcaaagttgacgga
agaggaagaaggattcgtatgccaatcatttgcgcagctcgagtttttcaattgaccaga
gagttaggtcacaagtccgatggtcaaaccatagagtggcttctccgtcaagctgagcct
tctatcatagccgccactggaactggcactactccggcgagtttctccactgcttctctc
tccacttcttctccgtttactctcgggaaacgtgtcgtcagagcggaggaaggagaatcc
ggcggcggaggaggaggagggttaacagtgggacacacaatggggacttcgttaatgggt
ggtggtggttctggtgggttttgggctgttccggcgaggccggatttcggacaagtctgg
agctttgcaaccggagctccaccggaaatggtttttgcgcagcagcagcaaccagctaca
ctcttcgtccgccaccagcagcaacagcaagcttccgccgccgcagcagctgcaatgggt
gaggcttcagcagctagagttgggaattatcttccgggtcatcatctcaatttgcttgct
tctttgtctggtggagctaacgggtcgggtcggagggaagacgaccacgaaccacgttga

KEGG   Arabidopsis thaliana (thale cress): AT5G23280
Entry
AT5G23280         CDS       T00041                                 
Name
(RefSeq) TCP family transcription factor
  KO
K16221  transcription factor TCP21 (protein CCA1 HIKING EXPEDITION)
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G23280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT5G23280
Transcription factors [BR:ath03000]
 Eukaryotic type
  Other transcription factors
   TCP
    AT5G23280
SSDB
Motif
Pfam: TCP Androgen_recep
Other DBs
NCBI-GeneID: 832392
NCBI-ProteinID: NP_197719
TAIR: AT5G23280
UniProt: Q9FMX2
LinkDB
Position
5:7842607..7844649
AA seq 250 aa
MSINNNNNNNNNNNDGLMISSNGALIEQQPSVVVKKPPAKDRHSKVDGRGRRIRMPIICA
ARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTASVSIRGATNSTSLD
HKPTSLLGGTSPFILGKRVRADEDSNNSHNHSSVGKDETFTTTPAGFWAVPARPDFGQVW
SFAGAPQEMFLQQQHHHQQPLFVHQQQQQQAAMGEASAARVGNYLPGHLNLLASLSGGSP
GSDRREEDPR
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtctattaacaacaacaacaacaacaacaacaataacaacgatggtcttatgatctca
tcaaacggagctttaatcgaacaacaaccatcagtcgttgtgaagaaaccaccggcgaaa
gatcgacatagcaaagtcgatggaagagggagaagaatccgtatgccgattatatgtgct
gctcgtgtttttcagctaacgagagagcttggtcataagtcagatggccaaacaattgaa
tggttacttcgtcaagcagagccttctattatagctgcaacaggaactggtacaactcca
gcgagtttctcaactgcttctgtctctatccgtggagccaccaattctacttctttagat
cataaacccacttctttacttggtggtacgtcaccgtttatacttgggaaacgtgttaga
gctgatgaggatagtaataatagtcataatcatagttctgttggtaaagatgagaccttt
acgacaacaccagctgggttttgggctgttccggcgaggccggattttggacaagtttgg
agttttgctggagctccacaagagatgtttttacaacaacaacatcatcatcagcaacca
ttgtttgttcatcagcaacagcaacaacaagctgcaatgggtgaagcttctgctgctaga
gttgggaattatcttccgggtcatcttaatttgcttgcttctttatccggtggatctccc
gggtcggatcgaagagaggaagatccacgttaa

DBGET integrated database retrieval system