KEGG   Arabidopsis thaliana (thale cress): AT5G15840
Entry
AT5G15840         CDS       T00041                                 
Symbol
CO
Name
(RefSeq) B-box type zinc finger protein with CCT domain-containing protein
  KO
K12135  zinc finger protein CONSTANS
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G15840 (CO)
SSDB
Motif
Pfam: CCT zf-B_box CEBP_ZZ
Other DBs
NCBI-GeneID: 831441
NCBI-ProteinID: NP_197088
TAIR: AT5G15840
UniProt: Q39057 A0A178UTB8
Structure
LinkDB
Position
5:complement(5170162..5173085)
AA seq 373 aa
MLKQESNDIGSGENNRARPCDTCRSNACTVYCHADSAYLCMSCDAQVHSANRVASRHKRV
RVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPILPISGNSFSSMTTTH
HQSEKTMTDPEKRLVVDQEEGEEGDKDAKEVASWLFPNSDKNNNNQNNGLLFSDEYLNLV
DYNSSMDYKFTGEYSQHQQNCSVPQTSYGGDRVVPLKLEESRGHQCHNQQNFQFNIKYGS
SGTHYNDNGSINHNAYISSMETGVVPESTACVTTASHPRTPKGTVEQQPDPASQMITVTQ
LSPMDREARVLRYREKRKTRKFEKTIRYASRKAYAEIRPRVNGRFAKREIEAEEQGFNTM
LMYNTGYGIVPSF
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgttgaaacaagagagtaacgacataggtagtggagagaacaacagggcacgaccctgt
gacacatgccggtcaaacgcctgcaccgtgtattgccatgcagattctgcctacttgtgc
atgagctgtgatgctcaagttcactctgccaatcgcgttgcttcccgccataaacgtgtc
cgggtctgcgagtcatgtgagcgtgctccggctgcttttttgtgtgaggcagatgatgcc
tctctatgcacagcctgtgattcagaggttcattctgcaaacccacttgctagacgccat
cagcgagttccaattctaccaatttctggaaactctttcagctccatgaccactactcac
caccaaagcgagaaaacaatgaccgatccagagaagagactggtggtggatcaagaggaa
ggtgaagaaggtgataaggatgccaaggaggttgcttcgtggctgttccctaattcagac
aaaaataacaataaccaaaacaatgggttattgtttagtgatgagtatctaaaccttgtg
gattacaactcgagtatggactacaaattcacaggtgaatacagtcaacaccaacaaaac
tgcagcgtaccacagacgagctacgggggagatagagttgttccgcttaaacttgaagaa
tcaaggggccaccagtgccataaccaacagaattttcagttcaatatcaaatatggctcc
tcagggactcactacaacgacaatggttccattaaccataacgcatacatttcatccatg
gaaactggtgttgtgccggagtcaacagcatgtgtcacaacagcttcacacccaagaacg
cccaaagggacagtagagcaacaacctgaccctgcaagccagatgataacagtaacacaa
ctcagtccaatggacagagaagccagggtcctgagatacagagagaagaggaagacaagg
aaatttgagaagacaataaggtatgcttcgaggaaggcatatgcagagataagaccgcgg
gtcaatggccggttcgcaaagagagaaatcgaagccgaggagcaagggttcaacacgatg
ctaatgtacaacacaggatatgggattgttccttcattctga

DBGET integrated database retrieval system