KEGG   Arabidopsis thaliana (thale cress): AT5G53000
Entry
AT5G53000         CDS       T00041                                 
Symbol
TAP46
Name
(RefSeq) 2A phosphatase associated protein of 46 kD
  KO
K17606  immunoglobulin-binding protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT5G53000 (TAP46)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ath01009]
    AT5G53000 (TAP46)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT5G53000 (TAP46)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     AT5G53000 (TAP46)
Membrane trafficking [BR:ath04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AT5G53000 (TAP46)
SSDB
Motif
Pfam: TAP42 Alba
Other DBs
NCBI-GeneID: 835379
NCBI-ProteinID: NP_568783
TAIR: AT5G53000
UniProt: Q8LDQ4 A0A5S9YDS1
LinkDB
Position
5:complement(21485317..21488042)
AA seq 405 aa
MGGLAMEEMPLSVLFEQARKIHLAASESGVDQDVVKKGCEMFQKCEDMIGKLALFSSNET
KEDISTNNLKYLLVPYYLAELTEKIIQEDRIQIVKASYAKLKEFFSFCEAMELVPDEELE
ASSRGGSGAPADRRALKIARFKRQKAAEAKLLEIKERKERRGRSTKASALSTPVESGEDD
IPDDDSEEEREAWLSSINLAICKAIDLLEMLKREEEMLSAIKERQLKDGEGGFSRDALDD
RTKKAETWHRDAAARIQYSKPAQPITCATFAQDVLEGRASVSQGHEHKNQPLIFGPASIV
GGPLSTERERMIAQVFQPSHRMPTMCIEDAGLTEMNIMNDWQEQTKKAIEEATTSWYNDK
PLRRKEEDEEDDDEDEEAVMKARAFDDWKDDNPRGAGNKKLTPCG
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgggtggtttggctatggaggaaatgcctttatcggtgctattcgagcaagctaggaaa
attcatcttgctgcttcagagtctggtgttgatcaggatgttgtgaagaaaggatgtgag
atgtttcagaagtgcgaagatatgatcgggaagctggcgctgttttcgtctaacgagact
aaagaagatattagcaccaacaatctcaaatatcttttggtgccttattatcttgcggag
ttgacagagaaaatcatacaggaggaccggattcagattgtcaaagcctcgtatgctaag
ttgaaggagttcttttcgttctgtgaggcaatggagcttgttccggatgaggagttggag
gcttcttcacgaggaggttctggtgcacctgctgatcgaagggctctcaagatagctcgg
ttcaaacgtcaaaaggctgcagaggcaaagcttcttgaaattaaagagaggaaggagcga
cgtggacgttccactaaagcatcagctttgtcgactccggttgaatctggagaagatgat
attccagatgatgacagcgaagaagagagagaggcctggctctcctcaattaacttggct
atttgtaaggctattgatctgttggaaatgctaaagagagaagaggaaatgctctctgca
ataaaggaaagacagttgaaggatggagagggtggattttctcgggatgctcttgatgat
cgtacaaagaaagctgaaacctggcacagagacgctgctgcaaggatacagtactctaaa
ccggcacaaccaatcacttgtgccacatttgcacaagatgtgttagaaggaagagcttcg
gtatcacaaggtcacgaacacaagaaccaacctcttatattcggtccagcaagcatcgtg
ggtggaccgctctctaccgagagagaaagaatgatagctcaggtcttccaaccaagtcac
aggatgccaacaatgtgcatagaggatgctgggttaacagagatgaacataatgaatgat
tggcaagagcagacgaaaaaagccattgaagaagcaaccacctcatggtacaatgataaa
cctctaagaagaaaagaagaagacgaggaagatgatgatgaagacgaagaagctgtgatg
aaagctagagctttcgatgattggaaggatgataatcctcgcggtgcaggtaacaagaaa
ctcacaccttgtggctga

DBGET integrated database retrieval system