KEGG   Arabidopsis thaliana (thale cress): AT5G60100
Entry
AT5G60100         CDS       T00041                                 
Symbol
PRR3
Name
(RefSeq) pseudo-response regulator 3
  KO
K12131  pseudo-response regulator 3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G60100 (PRR3)
SSDB
Motif
Pfam: Response_reg CCT VpsR Jas_motif
Other DBs
NCBI-GeneID: 836132
NCBI-ProteinID: NP_001331791
TAIR: AT5G60100
UniProt: Q9LVG4 A0A654GCP5
LinkDB
Position
5:complement(24197971..24201415)
AA seq 495 aa
MCFNNIETGDEVETERQVFGSSEEDEFRVEDTARNTNNVQISQQQQQPLAHVVKWERYLP
VRSLKVLLVENDDSTRHIVTALLKNCSYEVTAVPDVLEAWRILEDEKSCIDLVLTEVDMP
VHSGTGLLSKIMSHKTLKNIPVIMMSSHDSMVLVFKCLSNGAVDFLVKPIRKNELKNLWQ
HVWRRCHSSSGSGSESGIHDKKSVKPESTQGSENDASISDEHRNESGSSGGLSNQDGGSD
NGSGTQSSWTKRASDTKSTSPSNQFPDAPNKKGTYENGCAHVNRLKEAEDQKEQIGTGSQ
TGMSMSKKAEEPGDLEKNAKYSVQALERNNDDTLNRSSGNSQVESKAPSSNREDLQSLEQ
TLKKTREDRDYKVGDRSVLRHSNLSAFSKYNNGATSAKKAPEENVESCSPHDSPIAKLLG
SSSSSDNPLKQQSSGSDRWAQREAALMKFRLKRKERCFEKKVRYHSRKKLAEQRPHVKGQ
FIRKRDDHKSGSEDN
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgtgttttaataacattgaaactggtgatgaagtggaaaccgagaggcaagtgtttggt
tcatctgaagaagatgaatttcgagttgaagatactgctagaaataccaacaatgtacag
atttctcaacaacagcagcaaccgctagctcatgttgtgaagtgggagaggtatctccca
gttagatcgcttaaggttcttctggtggagaatgatgactcaacacgccatattgttact
gcccttttaaagaattgcagctatgaagttactgctgttccggatgtccttgaagcctgg
agaattctagaagatgagaaaagttgcattgatcttgtcttaacagaggttgacatgcct
gtgcattcaggaaccggtctgctgtccaagattatgagccataagacacttaagaacatc
cccgtcataatgatgtcatcacatgattctatggttctggtctttaagtgtttgtcgaat
ggtgctgttgattttctcgtgaaacccattagaaagaacgaactaaagaatctttggcaa
catgtctggagaagatgtcacagctctagcggaagcggaagtgagagtggaatacatgac
aagaagtcggtgaaacctgaaagcacccaagggtcagaaaatgatgccagcatcagtgat
gaacacaggaatgaaagtgggagtagtggtggtttgagtaaccaagatggtgggagtgat
aacgggagtggaactcagagttcttggacaaaaagagccagtgatactaagagcacctcg
ccttcaaatcaatttcccgatgcacccaacaagaaaggaacctatgaaaatggatgtgca
catgttaatagactgaaggaggctgaagatcagaaggaacaaataggcacgggatcacag
acaggaatgtctatgagtaagaaagctgaagaaccaggagatcttgaaaagaatgcaaag
tattctgttcaagctttggagagaaacaatgatgacacgctgaatcgctcttctggtaac
tcacaagtagaaagcaaagcaccttcatctaaccgagaagatttgcaatcactcgagcaa
actctgaaaaaaacaagagaggatagagattacaaagtcggtgatcgaagtgtgttgagg
cattcaaatctctctgcattctcaaaatacaataatggtgctacttctgctaagaaggct
ccagaagaaaatgtggaaagttgttctcctcatgacagtcctattgcaaaactgttgggt
tcgagttcaagcagtgacaatcctttaaagcagcagtctagtggaagtgaccgatgggca
caaagagaagctgctttgatgaagtttcgccttaaacgtaaagagcgatgttttgagaaa
aaggttaggtaccatagcaggaagaaactagctgagcaacggcctcacgtcaaaggtcaa
ttcattcgcaagagggatgatcataaatcaggaagtgaagacaattga

DBGET integrated database retrieval system