KEGG   Arabidopsis thaliana (thale cress): AT5G61380
Entry
AT5G61380         CDS       T00041                                 
Symbol
TOC1
Name
(RefSeq) CCT motif -containing response regulator protein
  KO
K12127  pseudo-response regulator 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G61380 (TOC1)
SSDB
Motif
Pfam: Response_reg CCT Peptidase_C6
Other DBs
NCBI-GeneID: 836259
NCBI-ProteinID: NP_200946
TAIR: AT5G61380
UniProt: Q9LKL2 A0A178UC73
LinkDB
Position
5:24674963..24678550
AA seq 618 aa
MDLNGECKGGDGFIDRSRVRILLCDNDSTSLGEVFTLLSECSYQVTAVKSARQVIDALNA
EGPDIDIILAEIDLPMAKGMKMLRYITRDKDLRRIPVIMMSRQDEVPVVVKCLKLGAADY
LVKPLRTNELLNLWTHMWRRRRMLGLAEKNMLSYDFDLVGSDQSDPNTNSTNLFSDDTDD
RSLRSTNPQRGNLSHQENEWSVATAPVHARDGGLGADGTATSSLAVTAIEPPLDHLAGSH
HEPMKRNSNPAQFSSAPKKSRLKIGESSAFFTYVKSTVLRTNGQDPPLVDGNGSLHLHRG
LAEKFQVVASEGINNTKQARRATPKSTVLRTNGQDPPLVNGNGSHHLHRGAAEKFQVVAS
EGINNTKQAHRSRGTEQYHSQGETLQNGASYPHSLERSRTLPTSMESHGRNYQEGNMNIP
QVAMNRSKDSSQVDGSGFSAPNAYPYYMHGVMNQVMMQSAAMMPQYGHQIPHCQPNHPNG
MTGYPYYHHPMNTSLQHSQMSLQNGQMSMVHHSWSPAGNPPSNEVRVNKLDRREEALLKF
RRKRNQRCFDKKIRYVNRKRLAERRPRVKGQFVRKMNGVNVDLNGQPDSADYDDEEEEEE
EEEEENRDSSPQDDALGT
NT seq 1857 nt   +upstreamnt  +downstreamnt
atggatttgaacggtgagtgtaaaggaggagatgggtttattgatagaagcagagtcagg
attttgctttgtgacaatgattccacgagtttgggagaggtttttactctcctttcagag
tgttcttatcaagtgactgcagtgaaatcagcaaggcaggtgattgatgcacttaatgca
gagggacctgatatcgatataatactggcggaaattgatctcccaatggctaagggtatg
aagatgctgaggtacatcacacgagacaaagatcttcgcagaatccctgtgataatgatg
tcgaggcaagacgaagtccctgtcgttgtaaagtgcttgaagctaggtgcagctgactac
cttgtgaagcctcttcgcaccaacgagcttctgaacttgtggacacacatgtggagaaga
agacgcatgctaggacttgctgagaagaatatgttgagctatgattttgatcttgtggga
tctgatcaaagtgatccaaacacaaatagtaccaacctgttctctgacgacacagatgat
agaagtcttaggtccaccaacccacagagaggaaatttaagtcaccaggaaaatgagtgg
tctgttgctactgctcctgttcatgctcgtgatggtggtcttggtgctgatggaacagcc
acttcttctcttgctgttactgctatagagcctccattggatcatcttgctgggtctcac
catgagccaatgaaaagaaatagtaatccagcgcaattttcttcagcaccgaagaaaagt
agattgaagatcggagagtcctctgctttctttacatatgtcaaatctactgtccttaga
actaacggtcaggatcctcctcttgtcgatggaaatggctcacttcatcttcatcggggt
ttggcggagaagtttcaagtggtggctagtgaagggatcaacaacaccaaacaagcacgc
agagcaacaccaaaatctactgtccttagaactaacggtcaggatcctcctcttgtcaat
ggaaatggctcacatcatcttcatcggggtgcggcggaaaagtttcaagtggtggctagt
gaagggatcaacaacaccaaacaagcacacagaagtagagggaccgagcaataccattct
caaggagagaccttgcagaatggcgccagctatccacattcccttgagcggtcacgcacg
cttcccacatcaatggaatctcatggtaggaactaccaagagggcaatatgaatattccc
caagttgctatgaacagaagtaaagattcgtctcaagttgatggatcgggtttctctgca
ccaaatgcctatccttactatatgcatggggtcatgaaccaagttatgatgcaatcagca
gccatgatgcctcaatatggtcatcaaattcctcattgccaaccaaatcatccgaatgga
atgacgggatatccttactaccaccacccaatgaacacatctttgcagcatagtcagatg
tctttacagaatggtcagatgtctatggttcatcattcttggtcaccggcaggaaatccg
ccttctaatgaggtgagggtaaataaacttgacagaagagaggaagctctgctgaaattc
agacgtaaaaggaaccaacgttgttttgataagaagattaggtatgtgaataggaaacgc
cttgctgagaggagaccccgcgttaagggtcagtttgttaggaagatgaacggcgtgaat
gttgatttaaatggacagcctgactctgctgactatgatgacgaggaagaggaggaagaa
gaagaagaagaggagaaccgggattcatctcctcaggatgatgctttgggaacttga

DBGET integrated database retrieval system