KEGG   Archangium violaceum: JQX13_30195
Entry
JQX13_30195       CDS       T07137                                 
Name
(GenBank) 3-oxoacyl-ACP synthase
  KO
K18003  anthraniloyl-CoA anthraniloyltransferase [EC:2.3.1.262]
Organism
avm  Archangium violaceum
Pathway
avm00405  Phenazine biosynthesis
avm01110  Biosynthesis of secondary metabolites
avm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:avm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    JQX13_30195
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JQX13_30195
Enzymes [BR:avm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.262  anthraniloyl-CoA anthraniloyltransferase
     JQX13_30195
SSDB
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N
Other DBs
NCBI-ProteinID: QRK04518
LinkDB
Position
7046088..7047059
AA seq 323 aa
MTRPSISFLGFGAALPERVRTSSDPIFDRIREEARAKGLSEASLFYGNREHRCLAPEESL
AALTAKAGTAALEDAGIRPDQVDRLYGYVSVPEFITPNELYAVHREVGLGSHAMVVPVQA
EFANFVMGAVLAWEAMLAGHSERALVAVGAGWTRNVDYAQGHAFGIGDGAGAAVLGLGER
LVLVDYAVDTFSDEYGSMTMRPRPESGFDRPVYGLEPARGLRSFLNSGMDGPPRLVERLL
RKHGLTGEDITLVSHQATRKLLDHWNEKIRPREYLHTLEDCGNMALASIPVTLARYHREL
RTKYLVLFGIGIGAHQMALLVRV
NT seq 972 nt   +upstreamnt  +downstreamnt
atgacgcgtccttcgatttccttcctgggctttggtgccgcgctgccggagcgggtgcgc
accagttccgatcccatcttcgaccggattcgcgaggaggcccgagcaaaggggctgtcc
gaagcctcgctcttctacggcaaccgggagcaccgatgcctggctccggaagagtccctg
gccgccctcaccgcgaaggcgggaaccgcggcgttggaggacgcgggcatccggccggat
caggtggatcggctctacggctacgtctccgtgcccgagttcatcacccccaacgagttg
tacgcggtccaccgggaggtgggcctgggctcgcatgcgatggtggtgccggtgcaggcc
gagttcgccaacttcgtcatgggcgccgtgctggcctgggaggcgatgctcgcggggcat
tcggagcgggcgctcgtggccgtgggggccgggtggacgcgcaacgtggactacgcgcag
gggcacgccttcggtattggagatggggcgggcgcggcggtgctcgggctcggggagcgg
ctcgtcctggtggactacgccgtggacaccttcagtgacgagtacgggtccatgaccatg
cgcccccgtcccgagagcggcttcgacaggcccgtgtacgggctcgagcccgcccgtggc
ctgcggtccttcctgaacagcggcatggacggaccaccgaggctcgtcgagcggctgctg
cgcaagcacggcctgaccggggaagacatcaccctcgtttcacaccaggccacgcggaag
ttgctcgaccactggaacgagaagatccgcccgcgcgagtacctgcacacgctcgaggac
tgcgggaacatggcgctcgcctcgattcccgtcaccctggcccgttaccaccgcgagctg
cgcacgaagtacctcgtcctcttcggcattggcatcggcgcgcaccagatggcgctgctg
gtgcgcgtgtag

DBGET integrated database retrieval system