KEGG   Acetobacterium woodii: Awo_c07520
Entry
Awo_c07520        CDS       T01732                                 
Symbol
mttA2
Name
(GenBank) methyltransferase 2 MttA2
  KO
K25221  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase [EC:2.1.1.378]
Organism
awo  Acetobacterium woodii
Pathway
awo00670  One carbon pool by folate
awo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Awo_c07520 (mttA2)
Enzymes [BR:awo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.378  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase
     Awo_c07520 (mttA2)
SSDB
Motif
Pfam: MtrH AKAP7_NLS
Other DBs
NCBI-ProteinID: AFA47546
UniProt: H6LKF6
LinkDB
Position
862758..863678
AA seq 306 aa
MFRFTAEQFIYDINGTKIGGQPGEYPTVLIGSIFYRGHKITQDSEKGLFDEVAAKELLDK
EAELSEETGNPRIVDVLGDTEIALTKHLEFVLKHTTSPVLLDSPSPEVRIETLKHFANDQ
EAMSRIIYNSLEESCTEHELEVMKDCGVKTAVVLAFSKKHLQPAKRVKLLIGDEKNEGLL
TKAKRAGVEQYLIDPGVLDVASSSWTAMAIRDIKEQHGFPGGCASSNALYLWKKMRSKGS
PYFEAAGASVFTFPLTHGADFILYGPMANAAWVYQAAATTDAMMAYCNKITGTKLGTLDT
PLMKIF
NT seq 921 nt   +upstreamnt  +downstreamnt
atgtttagatttacagcagaacaatttatttatgacatcaatggaactaaaattggtggg
caaccgggagaatatccaacggtattgattggcagtattttttatcggggtcataaaata
acccaagattcagaaaagggattatttgatgaggtcgctgcaaaagaactgctagacaaa
gaagcagaattatcggaagaaaccggcaatccaagaattgtcgatgtattgggagacact
gagattgcacttactaaacatctggaatttgttttaaagcatacaacatcaccagttttg
ctcgatagccccagtcccgaagtaagaatcgaaacattgaaacattttgccaatgatcag
gaagcaatgagtcgcattatttacaattcattagaagaaagctgcaccgaacatgaactc
gaagtcatgaaagattgtggtgtaaaaacggccgttgttttggcattcagtaaaaaacat
ttacagcccgccaaacgtgtcaaattgctgattggcgatgaaaaaaatgaagggttgttg
accaaggctaaacgagctggggtggaacaatatctgatagatcccggtgtgttggatgtt
gccagtagcagttggacagccatggcaatccgagatattaaagaacaacatggtttcccc
ggtggctgtgcctcatcgaacgctctttatttatggaaaaaaatgcgatcaaaaggaagt
ccttattttgaagcagcaggcgcttcagtatttactttcccattaacccatggtgctgat
tttattttatatggaccgatggctaatgccgcatgggtatatcaggcagcagcaacaacg
gatgcgatgatggcatattgtaataaaataaccggcacaaaactaggcacgttagatacc
ccgctgatgaaaattttctaa

DBGET integrated database retrieval system