Azospirillum sp. B510: AZL_015010 Help Entry AZL_015010        CDS       T01169                                  Symbol hfq Name (GenBank) host factor-I protein   KO K03666   host factor-I protein Organism azl  Azospirillum sp. B510 Pathway azl02024   Quorum sensing azl03018   RNA degradation Brite KEGG Orthology (KO) [BR:azl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AZL_015010 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AZL_015010 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:azl03019]     AZL_015010 (hfq)    03036 Chromosome and associated proteins [BR:azl03036]     AZL_015010 (hfq) Messenger RNA biogenesis [BR:azl03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AZL_015010 (hfq) Chromosome and associated proteins [BR:azl03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AZL_015010 (hfq) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hfq Hfq_1 EDC3_N LSM Motif Other DBs NCBI-ProteinID:  BAI72139 LinkDB All DBs Position complement(1735690..1735938) Genome browser AA seq 82 aa AA seqDB search MSEKSQNVQDVFLNHVRKNKTPVTVFLVNGVKLQGIITWFDNFSVLLRRDAHSQLVYKHA ISTVMPAHPIQLFEPPKEGESV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaaaaagccaaaacgtgcaggacgtgtttttgaaccacgtccgtaagaataag actcccgtaaccgtctttctcgtgaacggcgtgaaactccagggcatcatcacttggttc gacaatttctccgtactgctgcggcgcgacgcgcactcccagctcgtctacaagcatgcg atttcgaccgtcatgccggcccatcccattcaacttttcgagccgcccaaggaaggtgaa agcgtctga

DBGET integrated database retrieval system