Brucella abortus 63 75: DK49_876 Help Entry DK49_876          CDS       T03461                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism babt  Brucella abortus 63 75 Pathway babt02024   Quorum sensing babt03018   RNA degradation Brite KEGG Orthology (KO) [BR:babt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DK49_876 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DK49_876 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:babt03019]     DK49_876 (hfq)    03036 Chromosome and associated proteins [BR:babt03036]     DK49_876 (hfq) Messenger RNA biogenesis [BR:babt03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DK49_876 (hfq) Chromosome and associated proteins [BR:babt03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DK49_876 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AIJ81198 UniProt:  A0AAE9IL85 LinkDB All DBs Position 1:complement(871225..871461) Genome browser AA seq 78 aa AA seqDB search MAERSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVQMFEGEEA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctgaacgatcgcaaaatctacaagacctctttctgaattctgtccgcaagcagaag atttctctaacgatcttccttatcaatggcgtgaaattgaccggcattgtaacgtctttc gataatttctgcgtgcttctgcgtcgtgatggtcattcgcagcttgtttacaagcatgct atttcgacaatcatgccgagccagcctgtacagatgtttgaaggcgaggaagcctga

DBGET integrated database retrieval system