KEGG   Bacillus sp. BH072: OY17_08350
Entry
OY17_08350        CDS       T03582                                 
Name
(GenBank) transcriptional regulator
  KO
K05519  transcriptional activator of comK gene
Organism
bacb  Bacillus sp. BH072
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacb03000]
    OY17_08350
Transcription factors [BR:bacb03000]
 Prokaryotic type
  Other transcription factors
   Others
    OY17_08350
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: AJE78096
UniProt: A0A806Q8L8
LinkDB
Position
1662167..1663120
AA seq 317 aa
MITRLVMTFSVLLLLSGCAQTPFKGKIEKVGMLFPDTISDLVWGTKGYKGLLAIQSEFNV
DVYYKENIRSDEDILKAIDDFHKKGVNLLYGHGNEYEEIFNMISKDYPDMEFVVANGTAK
SDNVTSVHLMGEAMGFFGGMTAAHMSKNNEVGVIASFLWQPEVDGFIKGAKYEKPDITVN
TEFTDHWDNGNEALHLYEKLKAEGTDVVYPAGDGYNVPVIQQIKKDGLYAIGYVAEQSNL
GKNTVLTSTVQNVDKAYTLIAEQYNKGTLKSGDHNFDFREGVVEMGTFSPLVDKAFQDKI
SDLVKTYNRTNELPSNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcaccaggcttgtcatgaccttttctgtcctccttttattgagcggatgcgcacaa
actccgtttaaaggaaaaattgagaaggtcggaatgctttttcccgataccatcagtgac
ttggtatgggggacaaaaggttacaaaggtttattagcgatacaatctgaatttaacgtt
gacgtttattataaagaaaatatcagatccgatgaagatattttaaaagcgatagatgat
tttcataaaaaaggagtcaatcttttatacgggcacggaaatgaatacgaggaaattttc
aatatgatcagcaaggattatcccgacatggaattcgtcgtcgcaaacggaacggcgaaa
agcgataatgtcacaagcgttcatcttatgggagaagcaatgggctttttcgggggaatg
acggccgcccatatgtcaaaaaacaatgaggtcggcgtcatcgcctcttttttgtggcag
cctgaagtagacggctttatcaaaggagcgaaatatgaaaagcctgatatcaccgtcaat
actgaatttacggaccactgggataacggcaatgaagcgctgcatctttacgagaagtta
aaagcggaaggcacggatgttgtatatccggccggagacgggtataatgttcctgtcatt
cagcaaatcaaaaaagacgggctttacgccatcggctatgtcgccgagcaatcgaatctc
ggcaaaaacacggtgctgacaagcacggtgcaaaacgtagataaagcctatacattaatt
gccgagcaatataataaaggtacgctcaagagcggagatcacaactttgatttcagggaa
ggagtcgttgaaatggggacgttcagccctctggtggacaaagcatttcaagacaaaatc
tcagaccttgtcaaaacgtataacagaacaaatgaactgccgtcaaatgaatag

DBGET integrated database retrieval system