KEGG   Bacillus sp. BH072: OY17_12255
Entry
OY17_12255        CDS       T03582                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00780  Biotin metabolism
bacb01100  Metabolic pathways
bacb01240  Biosynthesis of cofactors
Module
bacb_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    OY17_12255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bacb00199]
    OY17_12255
Enzymes [BR:bacb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     OY17_12255
Cytochrome P450 [BR:bacb00199]
 Cytochrome P450, bacteria type
  CYP107 family
   OY17_12255
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AJE78834
UniProt: A0A806QEH3
LinkDB
Position
complement(2532219..2533415)
AA seq 398 aa
MTAGLSIAHPSLHADSDFWNDPYSFYDKLRSIDPVYKGTVLKYPGWYVTGYKEAAAILKD
TRFKNRIPLPEASTKYQNLSHIQHDMLLFKNQSDHKRMRMLIGKEFTAKTAESLRPCIKE
TVHDLLDQVQIKKNADLVSEFAFPLASLIIAEILGVPKEERYQFRQWTADVIQAIDLTRS
RKTLVRASDTAGRLTSYFRDLIHKRKAHPQQDLISRFIMEEQLSKEEVLATCILLVIAGH
ETTVNLMCNGVFTLLKHPEQLSALRENPSLIETAVEECLRYDSPAQLTARTASEDCEING
KTIKKGEQVYILLGAANRDPSIFDQPHKMDIQRKPNPHLAFGKNAHFCIGSSLARIEAQI
AILTLFERMPKLRLAAHRLEYRKLIGFRSLKELPVVIG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcgggcctatcgattgcacatccgtctctccatgcggattcggatttttggaat
gacccttactcgttttatgacaaactgcgatccattgatcctgtttataaagggaccgta
ttaaaatatccgggctggtatgtcaccgggtacaaagaggcggcagcgattctgaaagac
acccgatttaaaaaccgcattcctcttccggaagcttcaacgaaatatcaaaatctatcg
catatccagcacgatatgctgttatttaaaaatcaatcagaccataagcggatgcggatg
cttatcggtaaagaatttaccgcaaagacggcggaatcacttcgcccttgtataaaagaa
acggttcatgacttgttggatcaagtccaaatcaaaaaaaacgctgaccttgtttcagag
tttgcctttccattggcaagccttatcattgcggagatactcggagtgccgaaagaggag
agatatcaattcagacaatggacggcagacgtcattcaggccattgatcttacccgatca
agaaagacgttagtcagagccagcgacaccgcaggcaggctgacgtcatacttcagagat
ttgattcacaagcggaaagctcaccctcagcaagacttgatcagcaggtttattatggag
gaacagctttcaaaagaggaagtgctcgcgacatgtatcttacttgtcatagccggacac
gagacgacggtaaacctcatgtgcaacggtgtgtttactttattgaaacaccctgaacag
cttagcgcactgagagaaaacccctcgcttattgaaactgcagttgaggaatgtttgcgc
tacgacagccccgcgcagctgacggcacgcaccgcttcagaagactgtgaaataaatggg
aagaccataaaaaaaggagagcaggtatatatccttttaggagcagccaatcgcgatcca
agcatattcgatcaacctcacaaaatggatatccaaagaaagccgaatccgcatcttgca
ttcggaaagaacgcccatttttgtataggctcctcattagcgcgtatcgaagcacaaatt
gcaattctcacactgtttgagcggatgcctaagcttcggctggccgcacaccgccttgaa
taccgcaagctcattggttttaggtcgctcaaagagcttccggttgtcattggctga

DBGET integrated database retrieval system