KEGG   Bacillus sp. BS34A: BS34A_12470
Entry
BS34A_12470       CDS       T03833                                 
Symbol
med
Name
(GenBank) transcriptional activator protein med
  KO
K05519  transcriptional activator of comK gene
Organism
bacl  Bacillus sp. BS34A
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacl03000]
    BS34A_12470 (med)
Transcription factors [BR:bacl03000]
 Prokaryotic type
  Other transcription factors
   Others
    BS34A_12470 (med)
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_2
Other DBs
NCBI-ProteinID: CEJ76689
LinkDB
Position
I:1206603..1207556
AA seq 317 aa
MITRLVMIFSVLLLLSGCGQTPFKGKIEKVGMLFPDTINDLVWGTKGYKGLLNIQSKYNV
DVYYKEGVKTEEDIINAIEDFHKRGVNLLYGHGSEYAEVFNLVGEDYPDMEFVISNAKAK
ADNVTSVHFSGEAMGFFGGMTAAHMSKTNQVGVIASFTWQPEVDGFIKGAKYENPDIEVN
TKYTDHWDDDTTAVKLYQKMKNEGADVVYPAGDGYNVPVIQQIKKDGLYAIGYVTDQSDL
GENTVLTSTVQNVDKAYEIIAEQFNKGTLEGGDHYYDLNTGVVEMGTFSPLVDQDFQQRI
AKLIKTYNKTGELPKNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcacaaggcttgtcatgatcttttctgtcctccttttattgagtggatgtggacaa
actccgttcaaaggaaaaattgagaaggtcggcatgctctttcctgatacgattaatgac
ctcgtatggggcacaaaagggtataaaggattactgaatatacaatccaaatacaatgtg
gacgtctattataaagaaggcgttaaaacagaagaagatatcataaatgcgattgaggat
tttcataagaggggcgtcaatctgctctacggccatgggagtgaatatgctgaggtgttt
aacttggtcggcgaagattatccagatatggaattcgtcatttccaatgcgaaagcgaaa
gctgataatgtaacaagtgtccattttagcggggaagcaatgggcttttttggaggaatg
actgctgcccatatgtcgaaaacgaatcaggtcggtgtaattgcttcctttacgtggcag
cctgaggttgacggttttatcaaaggggccaagtatgaaaatccggatatagaggtaaat
acgaaatatacggatcattgggatgatgatacaacagcagtaaagctttatcagaaaatg
aagaacgaaggcgcggatgttgtgtatcccgccggagacgggtataatgttcctgttatt
cagcaaatcaaaaaagacggtctttatgccataggctacgtcacagatcaatcggatctg
ggcgagaataccgtattaaccagcacggtgcaaaatgtggacaaggcctatgaaatcatt
gctgaacaatttaataaaggcacccttgagggcggcgatcattactacgacctgaacacg
ggagtcgttgagatgggaacattcagcccgctcgtcgatcaagactttcagcaaagaatc
gccaagctgatcaaaacatacaacaaaacaggcgagctgccaaaaaacgagtaa

DBGET integrated database retrieval system