Bacillus sp. N1-1: GNK04_10610 Help Entry GNK04_10610       CDS       T11443                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bacn  Bacillus sp. N1-1 Pathway bacn02024   Quorum sensing bacn03018   RNA degradation Brite KEGG Orthology (KO) [BR:bacn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GNK04_10610 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GNK04_10610 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bacn03019]     GNK04_10610 (hfq)    03036 Chromosome and associated proteins [BR:bacn03036]     GNK04_10610 (hfq) Messenger RNA biogenesis [BR:bacn03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GNK04_10610 (hfq) Chromosome and associated proteins [BR:bacn03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GNK04_10610 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QHA91843 LinkDB All DBs Position 2025389..2025622 Genome browser AA seq 77 aa AA seqDB search MKQQINIQDQFLNQLRKDNVFVTVYLLNGFQLKGTIKGFDNFTIILESDGKQQLIYKHAI STFAPQRSVEINFESDK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaagcagcaaattaacatccaggaccaattcctgaaccaattaagaaaagacaacgtt tttgtaacggtatacctgcttaacggatttcagctaaaagggacaattaaaggatttgat aatttcacgattatccttgagtccgatggaaaacagcagttgatttacaaacacgccatt tctacgttcgctccacagcgatccgttgaaataaattttgaatctgacaagtaa

DBGET integrated database retrieval system