KEGG   Bacillus sp. Y1: DOE78_06525
Entry
DOE78_06525       CDS       T05922                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bacq  Bacillus sp. Y1
Brite
KEGG Orthology (KO) [BR:bacq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacq03000]
    DOE78_06525
Transcription factors [BR:bacq03000]
 Prokaryotic type
  Other transcription factors
   Others
    DOE78_06525
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: AYA75110
UniProt: A0A385NLP7
LinkDB
Position
1330456..1331418
AA seq 320 aa
MRKMFVRVGVLLLLSLPFLTSCGQPMSSGELKKVGLLVPETINDQVWGTKGYKGMLKIQS
RFKVDVYYKEDMNSEAIVERAVKEFEQKGVNLIFGHGNEYGPYFNNLADKYPEIHFVSFN
SDAHEENTTSLNFEAYAMGFFGGMVAGKMTKTNEIGIIAAYEWQPEVKGFLEGAQYQNKD
IAVQIDYVGHWDDDDKALSFLDHMMRNKVDVIYPAGDGYNVPVIEKIKENGLYAIGFISD
QSDLGESTVLTSTVQHVDRLYELVAEKYSKNELQSGNLTFDFQDNVISLGKFSPDVDQAF
EEEITALITKYKETGELPNQ
NT seq 963 nt   +upstreamnt  +downstreamnt
atgcgtaagatgtttgttcgggttggagtgttacttcttttaagcctacccttcctgaca
agctgtggacaacctatgtcttctggcgagctgaaaaaggtcggattattggtgccagaa
acaatcaacgatcaggtttggggaaccaaagggtataaaggaatgttaaaaattcaatcc
cgttttaaagttgacgtttattataaagaagacatgaactcagaggcaatcgttgaaaga
gcagtaaaagagtttgagcaaaaaggtgttaatctcatttttgggcatggcaatgagtac
ggtccatattttaacaacctagcagataagtaccctgaaatacattttgtgagttttaac
agtgatgctcatgaggaaaatacaacgagcttaaactttgaagcatatgctatgggtttt
tttggtggaatggtagcaggtaagatgacaaaaaccaatgaaatagggattatcgctgca
tatgaatggcagccagaagtaaaaggattccttgagggagctcaataccaaaataaggat
atagctgtacaaatcgattatgtcggccattgggacgatgatgataaggccttaagcttt
ttggatcatatgatgaggaacaaggtggatgtaatctatccagctggtgatggatacaat
gtgccagttattgagaaaataaaagaaaatggattgtatgcaataggttttatttccgat
cagtctgatttaggggaatcaactgttctgactagcaccgttcagcatgtagatagacta
tatgaattagttgctgaaaaatacagcaagaacgagttgcaatcaggaaaccttaccttt
gattttcaagataatgtgatctccttagggaaattcagccccgatgtggaccaagcattt
gaagaagaaataactgctttaattacaaagtataaagaaactggtgaattgccaaatcaa
tag

DBGET integrated database retrieval system