KEGG   Bacillus sp. SDLI1: AUL54_01365
Entry
AUL54_01365       CDS       T05207                                 
Name
(GenBank) non-ribosomal peptide synthetase
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    AUL54_01365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bacs01008]
    AUL54_01365
Polyketide biosynthesis proteins [BR:bacs01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    AUL54_01365
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AME05064
UniProt: A0A109WE69
LinkDB
Position
243843..251489
AA seq 2548 aa
MGQQPEIQDIYPLSFMQEGMLFHSLLDHDSRAYFEQAVFTISGQLDRERFQKSIDAVFER
YDIFRTTFIHKNVAKPRQVVLKNRPSRVQFHDISHLDEKAQDMYADRFGKEDKDKGFDLQ
SDPLMRVSILKKAPERYVCIWSHHHIVMDGWCFGIVMKEFLMIYQSLGDGRLPSLEPVQP
YGKYIKWLMKQDRKEAESFWKTRLADLEQTASLPKKSAEPNGELEQAVFTISEEQTNELK
NIAARAGATLNTVFQALWGILLQRVSRCEDAVFGSVVSGRPSDLAGVEKMVGLFINTIPV
RVKSGSFSFLELVRHLQQETLQAEAYSYYPLYDIQAQSPLKQALFDHIIVFENVPAQREI
ENVSQAGSFDFAVEDFTMEEVTNYGCSVKVIPGSSLYIRLNFDTGIYDRVFMKKIETFLR
HMMKSVISDPEMSASEIALLDACEARNMLDAFNRTEAAEPPAPTLHGLFTRRAALSPHRP
ALRFPDGMLTYAELDRYTDRLAVRLRQKGVRKESKVGVLAERSPEMVISVLAVLKAGGAY
VPLDPEYPEDRLRYMLKDSGACLLLQQSGLSVPGFSGETLEVSLSALTGETETGAVSEEA
DADSLAYIIYTSGSTGTPKGVAVEHRQAAAFLSGMQGQFPLTEEDIIVLKSSFSFDASIW
QLFWWTMSGASVYLLPAGWEKDPARMIEAFASEKVTTAHFIPAMVNSFLDALETEPEETR
IRLGKTLTRVFAGGEALSPLTAARFADLLPETVLIHGYGPTEATVDAAFYVCDRKRDSGR
TRLPIGKPVPGARLYVLDGGGTVQPAGVAGELYIAGTGVARGYLNRPELTAERFLDDPFY
PGERMYQTGDIARWTEDGLVEWLGRSDGQVKVRGYRIEPGEIEAAIRRIDGIREAAVTAR
TEHGETALYAYIEGRESDDVRAELAKRLPAYMMPAQFIEMSEWPVTPSGKLDRRALPAPD
GAAGRQAYTAPRNVTEMKLCALWEEVLKNGPVGIRDHFFERGGHSLKATALVSRIAKEFG
VQVPLQDIFARPTVEELAKVIQDLEESPYEAIQPAKTQDTYPVSSAQKRMYVLQQLEDGG
VGYNMPAVLELTGPLDRGRLEETFRQLVERHESLRTSFETGPDGEPVQRIHDSVPIQLDE
AESADAFVRPFCLEEGPLFRAALVKESDERHLLLTDMHHIISDGVSVNTLIKEFGELYAG
RPLAPMRLQYKDYAVWQRSFQEKEGYQKQEAYWLKRLEGELPVLELPADKPRPAVRSFAG
GNVSCTLDAETASGLHRIARDHGSTLYMVLLAAYNTLLARLSGQEDIIVGSPIAGRPHKD
LEPILGMFVNTLAIRTEPKGDKRFTDYLAEVRQAALEAYEHQDYPFEELVERLGVQRDTS
RNPLFDVMFVLQNMERESLVLNELHLTQAADTGHKTAKFDATLYAAEGSDGTISFDFEFN
ADIYQKQTIEKWLSYFTRILTKVIEDQTIPLGDIHVLDDAETNRVIYQFNQTKSDYPKHE
TISRLFERQAEETPDAQAVVYRGQTLTYRELNERANRIAAALRSNGAGPESVVALLTGRT
TELVSGILGILKAGGAYLPIADDVPRERAEWMLKDCKADILLQSDKVDGLPLSGKRLFIE
DIQTKAGLSSENPEPLGGPESLAYMIYTSGSTGAPKGVMVEQRSVIRLVKNSNYIDFTPK
DRLLFTSSLGFDVTTFEIFGPLLNGASLYVSDQETYLDSDVLDAFIQQNGITTLWLTSSL
FNHLSEQNEHVFSGLSRLIIGGEALSPSHVNRVRGALPHLAVWNGYGPTENTTFSTCFLI
EQSYDHSIPIGRPVGNSTAYIINGRGTPQPIGVIGELCTGGDGVARGYFGRPELTEEKFV
PNPFVPGERMYRTGDLARWLPDGTIEYAGRMDDQVKIRGYRVELGEIEAALRSLDGVKEA
AVSVRTGQSGNKELIAYMSLQADMNIETVRSLLSQRLPNYMVPSYMMELERLPLTPNGKL
DRKNLPEPELALQTVYTAPRTELEEQLSVIWQEVLGAKQVGIEDSFFELGGDSIKALQVS
ARLGRYGWKMAASDLFRHPTIKELAPLIRKAERVIDQRPVEGDIPWTPVQHWFLSQRMEN
RNHFNQSVMMFSSDALRKQPLKEALQHLVIHHDALRITASAENGSHRQINHGIQKDELYS
LDIWDLSETDSREREIETEVAALQQRMDIEKGPLLKAGWFKTRSGDYLFITIHHLAVDGV
SWRILLEDLSAAYTQAVKGQPVQLPPKTDSFKQYAERLSEYAKSSKLMREEDDWRFIEEE
TAAALPYEKPLHQTGADSIRQTVSFTLSEEETSVLLQQVNRAYHTDTQDILLTAAALALR
DWTGGRLRIAMEGHGREHIMPELDISRTVGWFTSMYPVLIDLNTAGSELGTAVKTVKDTL
GRIPDKGIGYGILKYMTPPEQKTIRFGQAPEISFNYLGQFNDTEDQHTFSLSGLASGHDI
TPTWQREQAVEMSAMAAQHKLHFSLSYPPSRFRKETMEQLLQTLQQYLRGIMAHCTGKEE
SEKTVSDFSSKTLTSDDLDSIASFVEEL
NT seq 7647 nt   +upstreamnt  +downstreamnt
atggggcagcaaccggaaatacaagatatatatcctttatcttttatgcaggagggcatg
ctttttcattctcttttggatcatgactcaagagcctacttcgaacaagcagtgtttacg
atcagcggacagcttgaccgggaacgattccaaaaaagtatagatgctgtttttgaacga
tacgatattttccgtacgacgtttattcataagaatgtggcgaagccccgccaagtcgtg
ttaaaaaacaggccgagccgcgttcagtttcatgatatttctcatttggatgaaaaagcg
caagacatgtatgccgaccggttcggtaaagaagacaaagataaaggctttgatttgcaa
tcagaccctctcatgagagtctccattctgaaaaaagcgcccgaacgctatgtttgtatt
tggagccaccatcatatcgtcatggacggctggtgcttcggaattgtcatgaaggaattt
ctgatgatctatcaatctctcggagacgggcggctcccgtctctcgagcctgttcagcca
tatggaaagtatattaaatggctcatgaagcaagatcgtaaagaagccgagtcattttgg
aaaacgagacttgccgatcttgagcaaacggcgtctcttccgaaaaaatccgcggaacca
aacggcgagcttgagcaggctgttttcactatttctgaagagcagacaaatgagctgaag
aacattgcggcaagggcgggggcaacgctgaatacggtgtttcaggcactgtggggcatt
ttgctgcagcgagtcagccgctgcgaagacgccgttttcggttctgtcgtttccggccgg
ccgtcggatctggcgggcgtagaaaaaatggtaggactgtttatcaatacgattcccgtg
cgggtaaaaagcggttcgttttccttcctggagctcgtcagacatttgcagcaggagacg
ctgcaagcagaagcgtacagctattatccgctgtatgacattcaggcgcaaagccctctg
aagcaggcgttgtttgaccatattatcgtgtttgaaaatgtgccggcccagcgtgaaatt
gaaaatgtgagtcaggccggttcatttgattttgcggtagaggatttcacgatggaggaa
gtcacaaactacggatgcagcgtaaaagtgattccgggaagttctctttatatccgctta
aactttgataccggtatatacgatcgtgtttttatgaagaagattgaaacctttttacgg
catatgatgaaatcagtcatttccgatcctgaaatgagcgcctccgagatcgcattgctg
gatgcgtgtgaagccagaaatatgctggatgcgtttaaccgtacagaagcggctgaaccg
ccggccccgacgctgcacgggctgtttacccgccgcgccgcgctttctccgcaccgtccg
gcgcttcgtttcccagacggtatgctgacgtacgccgagcttgaccggtatacagacagg
ctcgctgttcggctccgccaaaaaggcgtccgcaaagaaagcaaggtcggcgtgctcgct
gaacgctcgccggagatggtgatttcagtgcttgccgtgttaaaagcgggcggcgcctac
gtgccgcttgacccggaatatcctgaggacaggcttcgctatatgctcaaagacagcggc
gcctgtctcctgcttcaacagtcgggattatccgttcccggtttttccggcgagacgcta
gaagtgtctctttctgcccttacaggtgagacggagacaggggctgtctctgaagaagcg
gatgccgattcgctcgcttatattatttacacgtccggttcgacgggaacaccgaagggg
gtggctgttgaacaccgtcaggccgccgcctttttatccgggatgcaagggcagtttccg
ttaacggaagaggatataatcgtgctgaaatcatccttttccttcgacgcttccatctgg
caattgttttggtggacgatgtcaggcgcctccgtgtatctgcttccggccggatgggag
aaagatcccgcgcggatgatcgaagcgtttgcctcggaaaaggtgacgaccgcgcatttt
attccggcgatggtcaacagctttttagacgcgctggaaacagagcctgaggaaacaaga
atccgccttggcaaaaccttgacacgcgtgtttgccggaggggaagctctttcgccgctt
acggctgcccggtttgctgatcttctgccggagaccgtgctcatccacggttacgggccg
acagaagcgacggttgatgcagcgttttacgtctgtgaccgaaaacgggacagcggacgg
acaaggcttccgatcggaaaacccgttccgggtgcccgtctttatgtgttagacggcggg
ggaaccgttcagcctgcgggcgttgccggagagctgtacatcgcggggacaggggtggcc
cggggctatttgaaccgtcctgaactgacggcagaacgttttctcgatgatccgttttat
ccgggagaacgcatgtatcagacgggcgatatcgcacgctggacagaagacgggcttgtc
gaatggctcggccgttcagacggacaggtgaaagtccgcggctaccggatcgaaccgggg
gaaatcgaagcggcgatccggcgcattgacggcattcgtgaggcggcggtcaccgcccgg
accgaacacggcgaaaccgcgctttacgcctatatcgaaggacgggaaagcgatgacgtg
cgggcagaacttgcgaaacgccttccggcctacatgatgccggctcagtttattgagatg
agcgagtggccggtcacaccgagcggaaagcttgaccgccgcgcgctgccggctcctgac
ggagcggcaggcagacaggcgtacaccgcaccgcggaacgtcacggaaatgaagctttgc
gccctttgggaagaagtgctgaaaaacggccccgtcggcatccgggatcacttttttgag
cggggcggccattcgttaaaagcgacggctctcgtctcccgcatcgccaaagagttcggc
gttcaggtgccgttacaggacatcttcgcccggccgacggtggaagagctcgctaaggtc
attcaggacctcgaagagagcccgtatgaagcgattcagccggcgaaaacacaagacact
tatccggtgtcttcagcgcagaaacggatgtatgtgctccagcagcttgaagacggcggt
gtcggctacaatatgccggcagtgctggaactgacggggccgcttgaccgcggccggctg
gaggagacgttccggcagcttgtggagcggcacgagtcgctcagaacgtcctttgaaacg
gggcctgacggcgaaccggtgcagcgcatccatgacagcgtgccgattcagctggatgaa
gccgagtcagcagacgcgttcgtccggccgttttgtctggaggaagggccgctcttccgg
gcggcccttgtgaaagaatcggatgaacgccatcttttattaacggatatgcatcacatt
atttccgatggtgtgtccgtcaacaccttgattaaagaattcggcgagctgtacgccggc
cgcccgcttgcaccgatgcgtcttcaatataaagactatgccgtctggcagcggtcgttt
caggagaaggaaggatatcagaagcaggaagcctactggctgaagcggcttgaaggcgag
cttccggtgcttgagcttccggctgacaagccccgtccggctgtcagaagctttgcgggc
gggaacgtatcgtgcacgcttgacgctgaaacggcatctggtcttcaccgcatcgcccgc
gatcacggctccactttgtacatggtgcttctcgccgcgtacaatacgctgctcgcacgc
ctgagcggacaggaagacattatcgtcggctcgccgattgccgggcgcccgcataaagac
cttgaaccgattctcggaatgttcgtcaacacgctcgccatcagaacggagccgaagggg
gacaaacggtttaccgattacttggcggaagtccgtcaggccgcactggaagcgtatgag
catcaggactatccgtttgaagagcttgtggaacggctcggtgtgcagcgggacacaagc
cgcaatccgctgtttgacgtgatgtttgtgctccagaatatggagcgtgaatccttggtt
ttaaatgagctgcatttgactcaagctgcggataccggccataaaacagcaaaatttgat
gccacgctttatgcggcagaagggtctgacggcaccatcagctttgattttgaattcaat
gcagatatctatcaaaaacagacaatcgaaaaatggctttcttattttacccgtattctt
acgaaagtgattgaagaccaaacaataccgcttggtgacattcacgtgctggatgatgct
gaaacaaatcgcgtcatttatcaatttaatcagacgaaaagcgattatcccaaacacgaa
accatcagccgtttatttgagcggcaggcggaagaaacccctgatgcccaggctgttgta
tatcgcggacaaaccttgacatacagagagctgaacgaacgggctaacagaattgctgcg
gcgctccgatcaaatggcgccggtccggaaagtgtggtcgcactattaaccggccgcaca
acagagcttgtttccggcattcttggaatattaaaagcggggggcgcctacttgcctatc
gctgacgatgtgccgcgggaacgggctgaatggatgcttaaagactgcaaagctgatatt
ctccttcaatctgataaagttgacggtctgccgctttcaggaaaacgtttattcatagag
gatattcaaacaaaggccggcttgagttcggaaaatcccgaaccgctcggcggacccgaa
tcattggcctacatgatttatacatccgggtcaacaggcgcgccaaaaggcgtcatggtt
gaacagcgaagcgtgatccgccttgtgaaaaacagcaattatattgatttcacgccgaaa
gacagactgttgtttacttcatcattaggatttgacgtcacgacatttgagatattcggc
ccgcttttaaacggtgcttctctatatgtaagtgaccaggaaacctatctcgattctgat
gttttggatgcatttatacagcaaaacggtataacgacactttggcttacatcgtctctg
tttaaccatttatccgaacaaaatgaacatgtgttttcgggattatcacgattgattatc
ggcggagaagcactgtccccaagccatgtcaaccgggttcgtggagcactgccgcatctt
gcagtatggaatggatacgggccgactgaaaatacaacgttctcgacatgctttttgatt
gaacaatcatacgatcattcgatcccgatcgggcgccctgtcggaaattcaaccgcgtat
atcataaacggcaggggaacacctcagccgatcggcgtcatcggcgaattatgcacgggc
ggagacggtgtggcgagaggatatttcggacgtcctgagctgacggaagaaaaatttgtc
cctaatccatttgttcccggagaacgaatgtaccgcaccggagatttagcccgctggctg
ccggacggaacgatcgagtatgccggacggatggatgatcaagtgaaaatccgcggttat
cgggtggagctgggagagatcgaggccgctctgaggagcttggacggcgtgaaagaagcc
gcagtgtcagtcagaaccggacagtccggcaataaagaactgatcgcatacatgagcctg
caggcggacatgaacatagaaacagtgcgttctttactttctcagcgcctgccgaattac
atggttccgtcctatatgatggagcttgagaggctgccgcttacgccgaacggtaaattg
gatcggaaaaatctgcccgaaccggagctcgcgcttcaaaccgtatacacagctccccgc
actgagcttgaagaacagctttccgtgatctggcaggaagtgctcggcgcaaagcaagtc
ggaattgaagactcattttttgaattgggcggcgattcaatcaaagcgctgcaagtttcc
gcgcggctcggacgctatgggtggaaaatggcggcaagtgacttgttccgccatccgacc
attaaggaactcgcgcctcttatccggaaagcggaaagagtcatcgatcagcggccggtt
gaaggggatattccttggacccccgttcagcactggtttttatcacagcggatggaaaac
agaaatcatttcaatcagtccgtcatgatgttcagctcggacgctttgcgtaaacagccg
ctcaaagaagctttgcagcatctcgtcattcatcatgatgcactccggatcaccgccagt
gcagaaaacggaagtcacagacaaatcaatcacggcatccaaaaagatgaactgtacagc
ttggatatatgggatctgtctgaaacggattcacgggaaagagaaatagaaactgaagtg
gctgcactccaacagcggatggatattgaaaaagggccgttattaaaagccggctggttc
aaaacccggtctggggattatttattcattaccatccatcacttggcggttgacggagtg
tcatggcgtattttgctggaggatttatcagccgcttacactcaagctgtaaaaggtcag
ccggttcagcttccgccaaagactgattcctttaagcagtacgcagaaaggctttccgaa
tacgcgaaaagcagcaagctgatgcgagaagaagacgattggcgttttattgaagaagaa
accgccgccgcacttccttatgaaaaaccgctgcatcagacgggagccgacagtattcgg
caaacggtaagctttacgctttcagaagaagaaacgtccgttttgctgcagcaggtcaac
cgggcctaccataccgatacgcaggatattcttctgactgcggcagccttggctttacgg
gactggacaggaggcagactccgcatcgcgatggaagggcacggaagagagcatatcatg
ccggagcttgacatcagccgcaccgtaggctggtttacttccatgtatccggtgctcatt
gacttgaatacagccggttcagaacttgggacggcggtaaaaacagtaaaagacacactc
ggaagaataccggataaaggaataggctacggcattttaaaatatatgacaccgcccgag
caaaaaacaattcggttcggacaagcgcctgaaatcagctttaactatttagggcaattc
aatgatacggaagatcagcacacgttcagtttatccggtcttgcgagcgggcacgacatt
acgccgacatggcagcgggaacaagcggtggaaatgagcgcgatggctgcacagcacaag
cttcacttcagtttgagctatccgccgagccgctttcgcaaagaaacgatggaacagctg
ctgcaaaccttacaacaatatttgcgtggaattatggcgcactgcaccggcaaagaagaa
tcagaaaaaaccgttagtgattttagcagcaaaacgttaacatctgatgatttggacagc
atagcgagttttgtcgaagaactgtag

DBGET integrated database retrieval system