KEGG   Bacillus sp. SDLI1: AUL54_01465
Entry
AUL54_01465       CDS       T05207                                 
Name
(GenBank) cytochrome
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00780  Biotin metabolism
bacs01100  Metabolic pathways
bacs01240  Biosynthesis of cofactors
Module
bacs_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AUL54_01465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bacs00199]
    AUL54_01465
Enzymes [BR:bacs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     AUL54_01465
Cytochrome P450 [BR:bacs00199]
 Cytochrome P450, bacteria type
  CYP107 family
   AUL54_01465
SSDB
Motif
Pfam: p450 DUF1985 HU-CCDC81_euk_2
Other DBs
NCBI-ProteinID: AME05084
UniProt: A0A0X8KDG2
LinkDB
Position
283279..284475
AA seq 398 aa
MTAGVSISHPSLQADSDFWNDPYPFYDNLRAIDPVYKGTVLKYPGWYVTGYKEAAAILKD
TRFKNRVPLPETSTKYQNLSHIQHDMLLFKNQSDHKRMRMVIGKEFTAKTAESLRPCIKE
TVHDLLDQVQNKKTADLVSEFAFPLASLIIAKILGVPKEERYQFRQWTADVIQAIDFTRS
RKTLVRASDTQGRMTSYFRDLIHKRETHPKEDLISRFIMEEQLSKDEVLATCVLLIIAGH
ETTVNLISNGVYTLLKHPEQLSALRENPTLIETAVEECLRYDSPTQLTARTASEDCEIYG
KIIKKGEQVYILLGAANRDPSIFDQPHKMDIERKPNPHLAFGKNAHFCVGSRLARIEAQI
AILALLERLPKLRLAAPKLEYRKLIGFRSLTELPVVVG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcgggcgtatcaatttcacatccgtccctccaggcggattcggatttttggaat
gacccttacccgttttatgacaacctgcgggccattgatcctgtttataaaggaaccgta
ttaaaatatccgggctggtatgtcaccgggtataaagaggcggcagcgattctgaaagac
acccggtttaaaaaccgagttcctcttccggaaacatcaacgaaatatcaaaatctatcg
catatccagcacgatatgctgttatttaaaaatcaatcagaccataagcggatgcggatg
gttatagggaaagaattcaccgcaaagacggcggaatcactccgcccctgtataaaagaa
acggtgcatgacttattggatcaagtgcaaaacaaaaaaaccgcagaccttgtttcagag
tttgcctttccattggcaagcctcatcattgcgaagatactcggagtgccgaaagaggag
agatatcaattcagacaatggacagcagacgtcattcaggccattgattttacccggtca
agaaaaacattagtcagagcaagcgacacccaaggcaggatgacgtcatatttcagagat
ttgattcacaagcgggaaacgcatcccaaggaagacttaatcagcaggtttattatggag
gaacagctttcaaaagacgaagtactcgcgacatgtgtattacttatcatagccggacac
gagacgacggtaaacctcataagcaacggtgtgtatactttattgaaacaccctgaacag
cttagcgcactgagagaaaaccccacgcttattgaaactgcagtcgaggaatgtttgcgt
tacgacagccctacacagctgacggcccgcaccgcttcagaagactgcgaaatatatgga
aagatcataaaaaaaggagagcaggtatatatccttttaggtgcagccaatcgtgatcca
agcatattcgatcagcctcacaaaatggacattgaaagaaaaccgaatccgcatcttgca
ttcggaaagaatgcccatttttgcgtgggttcacgattagcgcgcattgaagcacaaata
gccattctcgcgctgttagagcggttgcctaagcttcggctggccgcacctaagcttgaa
taccgcaagctcattggttttagatcgctcacagagcttccggttgtcgtcggctga

DBGET integrated database retrieval system