KEGG   Bacillus sp. SDLI1: AUL54_04975
Entry
AUL54_04975       CDS       T05207                                 
Name
(GenBank) transcriptional regulator
  KO
K05519  transcriptional activator of comK gene
Organism
bacs  Bacillus sp. SDLI1
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacs03000]
    AUL54_04975
Transcription factors [BR:bacs03000]
 Prokaryotic type
  Other transcription factors
   Others
    AUL54_04975
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: AME05754
UniProt: A0A109WJA4
LinkDB
Position
complement(1107880..1108833)
AA seq 317 aa
MITRLVMVFSVLLLLSGCAQTPFKGKIEKVGMLFPDTISDLVWGTKGYKGLLAIQSEFNV
DVYYKENIRSDEDILKAIDDLHKKGVNLLYGHGNEYEEIFNMISKDYPDMEFVVANGTAK
NDNVISVHLIGEAMGFFGGMTAAHMSKTNEVGVIASFLWQPEVDGFIKGAKYEKPDITVN
TEFTDHWDNGNEALHLYKKLKAEGTDVVYPAGDGYNVPVIQQIKKDGLYAIGYVAEQSNL
GKNTVLTSTVQNVDKAYTIIAEQYNNGTLKSGDHNFDFREGVVEMGTFSPLVDKAFQDKI
SDLVKTYNRTNELPSNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcaccaggcttgtcatggtcttttctgtcctccttttattgagcggatgcgcacaa
actccgtttaaagggaaaattgagaaggtcggaatgctgtttcccgataccatcagtgac
ctggtatggggcacaaaaggttacaaaggtttattagcgatacaatctgaatttaacgtt
gacgtttattataaagaaaatatcagatctgatgaagatattttaaaagcgatagatgat
ttgcataaaaaaggagtcaatcttttatacgggcacggaaatgaatacgaggaaatcttc
aatatgatcagtaaggattatcccgacatggaattcgtcgtcgctaacggaacggcgaaa
aacgataatgtcataagcgttcatcttataggagaagcgatgggcttttttgggggaatg
acggccgcccatatgtcaaaaaccaatgaggtcggcgtcatcgcctcgtttttatggcag
cctgaggtagacggctttattaaaggggcaaaatatgaaaagcccgatattaccgtcaat
actgaatttacggaccattgggataacggcaatgaagcactgcatctttataagaagtta
aaagcagaaggcacggatgttgtatatccggccggagacgggtataatgttcctgtcatt
cagcaaattaaaaaagacgggctttacgccatcggctatgtcgccgagcaatcgaacctc
ggcaaaaacacggtgctgacaagcaccgtgcaaaatgtagacaaagcctatacaataatc
gccgagcaatataataacggcacgctcaagagcggagatcacaacttcgatttcagggaa
ggagtcgttgaaatggggacgttcagccctctggtggacaaagcatttcaagacaaaatc
tcagaccttgtaaaaacgtataaccgaacaaatgaactgccgtcaaatgaatag

DBGET integrated database retrieval system