KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003166
Entry
103003166         CDS       T03086                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103003166 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bacu04050]
    103003166 (TNFRSF8)
   04090 CD molecules [BR:bacu04090]
    103003166 (TNFRSF8)
Cytokine receptors [BR:bacu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103003166 (TNFRSF8)
CD molecules [BR:bacu04090]
 Proteins
  103003166 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 103003166
NCBI-ProteinID: XP_007170129
UniProt: A0A383Z5G7
LinkDB
Position
Un
AA seq 488 aa
MFCGTSVINSCARCLPHSVCPTGMVVKFQGTAQRNTVCEPPSPGTTPNCGASPQDCKAPA
SSTIPQAKPTLTSPASSDARTTLLGGGTPLAPEDASKITAHSSSSVGKLNPDPGLTLPQL
CPQGSADCRKQCDPDYYLDRDGRCTACVSCSGDHLVEKTPCMWNSSRVCECRPGMFCATS
ATNSCARCVTHPVCPPGMVTKLQGTAERDTTYEPPPPGTHSNCSTNAEDSGVPASPTPSL
ISLADSLTGKEHGGDVTHVRGRASISTSTPISFSSTGKPTLVSGPVLFWVILTLVVVVSF
GSFLLCHRRGCRKWMGQKLHLCYPVQTFQPKLEPVDSRPGRNPTLIRRVSVAEPGSEEQG
LMSPPAVETCPNLESLQLLEASPASSPSTPMDLPEPRGTTEHTNNRIENIYIMKADTVIV
GTVKAKVPEGQGPVGPAGPEFEEDLEVDHAPHYPEQETEPLTGSCGGVMFSVEEEGKEDP
LPTTASGK
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgttctgtggtacatcagtcatcaactcctgtgcccgctgcctccctcactccgtctgc
ccgacagggatggttgtcaagttccagggcacagcgcagaggaacactgtctgtgagccg
ccttccccagggaccacccccaactgcggcgccagcccacaggactgcaaggcccctgcc
agcagcaccatcccccaggccaagcccaccctgacctctccagcaagctctgatgccagg
accacacttcttggagggggcacccccctcgccccagaagatgcttctaaaatcactgcc
cactctagctcctccgtggggaagctcaatccagatccagggctgaccctgccacagcta
tgccctcaggggtctgccgactgcaggaagcagtgtgaccctgactactacctggacagg
gatggtcgctgcacggcctgtgtgagctgttcaggagaccacctcgtggagaagacacct
tgcatgtggaactcctcccgtgtctgcgagtgtcgacctggcatgttctgtgccacgtca
gccaccaactcctgtgcccgctgcgtcacccaccccgtctgcccaccagggatggtcacc
aagctccagggtacggctgagagggacaccacctatgagccacctcccccggggacccac
tctaactgcagcaccaacgcagaggacagcggggtgcccgccagccccaccccctccctg
atctccctggccgactccctgactggtaaggagcatggaggggacgtcacccacgtgcgg
ggacgcgcctctatctcaaccagcactcccatctccttctcctccacagggaagcccact
ctggtttcaggacctgtgctcttctgggtgatcttgacactggtggtggtcgtcagcttt
ggctcctttctcctgtgccaccggaggggctgcaggaagtggatggggcagaagctccac
ctgtgctacccagtccagaccttccagcccaagctggagcctgtggattccaggcccggg
aggaacccgacactgatcaggagggtgtcagtggcggagccgggcagtgaggagcagggg
ttaatgagccccccagctgtggagacctgccccaacctggagagcctgcagctgctggag
gccagcccagccagcagcccctccacccccatggaccttcccgagccccgagggaccacg
gagcacaccaacaacaggattgagaacatctacatcatgaaggccgacaccgtgattgtg
gggaccgtgaaggccaaggtgcctgagggccagggcccggtggggccggcagggcccgag
ttcgaggaggatctggaggtggaccatgccccccactacccggagcaggagacggaacca
ctgacgggcagctgtgggggcgttatgttctcggtggaggaggaagggaaggaggacccc
ttgcccacgaccgcctctgggaaatga

DBGET integrated database retrieval system