KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005012
Entry
103005012         CDS       T03086                                 
Symbol
ITGAX
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04610  Complement and coagulation cascades
bacu04810  Regulation of actin cytoskeleton
bacu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103005012 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    103005012 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103005012 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:bacu04515]
    103005012 (ITGAX)
   04090 CD molecules [BR:bacu04090]
    103005012 (ITGAX)
Cell adhesion molecules [BR:bacu04515]
 Integrins
  Integrin alpha subunits
   103005012 (ITGAX)
CD molecules [BR:bacu04090]
 Proteins
  103005012 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 103005012
NCBI-ProteinID: XP_007186521
UniProt: A0A384AGP1
LinkDB
Position
Un
AA seq 1173 aa
MSMSDLPVMTRTRIFLLLLMALASSFCFNLDIDQPTTFHVNSAGFGYSVVQYANWVVVGA
PQEIKAADQTGGLYQCDYSVGKCEPILLPVPPEAVNMSLGLSMVATTSPFRLLACGPTVH
HACRENMHLTGFCFLLASPSWQAQRIPAALQECPRQEQDIAFLIDGSGSISATNFAKMLN
FVKAMMRQFQRPSSQFSLVQFSHKFQVHFTFKAFAASSNPLSLXXXXXXXXLNSVQKLSG
YTYTATAIRRVTEQLFSALYGARKDASKILIVITDGQKKYDPLDYKDVIPSAEAAGIIRY
AIGVGLAFQNIHSWQELKDIASKPSHEHIFKVENFDALRDIQNQLKEKIFAIEGTQTISS
SSFELEMSQEGFSAVFMPDGPVLGAVGSFSWSGGAFLYPPNRSPTFINMSQEHADMRDSY
LGYSTELAIWKGVHSLVLGAPRHQHTGKVVIFTQVSGQWRPKAEVTGTQIGSYFGASLSS
VDVDRDGSSDLVLIGAPHYYEQSRGGQVSVCPLPQARAKWQCGAVLRGEQGHPWGRFGAA
LTVLGDVNGDRLTDVAIGAPGEQENQGAVYLFHGTSGLGISPAHSQRITGAQFSPSLQYF
GQSLSGGQDLTMDGLVDLAVGAWGHALLLRTRPVLRVWANIRITPPEITRSVYECHQQLA
FAQSLGEAIVCLRVSQSPKNRLANLQSIVTFDLTLDPGRLSPRAVFEETRTRNLTRVRDL
GLTQHCEPVRLLLPACVEDSVTPIILRLNFSLVGKPVSGFGNLQPMLAVDAQRYFMTSLP
FEKNCGADHVCQDDLGISFGVSGLKTLIVGSNLELNLEVRVWNDGEDSYGTTITFFYSPG
LSYRRVAGGQLQSRSLRLTCDSAPTRSQGTLSTRCSINHLIFREGAQITFMATFDVSPTA
MLGDRLLLAANVSSENNTPKMSKTTFRLELPVKYAVYTVISSHEQSTKYLNFSASEEEES
SGAQHRYQVNNLGQRDLPVSIDFSVPVELNRLAVWKDVDVLHPQNPSIQCSSERTVPTES
DFLTHLQKKPVLDCSVADCLRFRCDIRSFGVQEELDFILKGNLSFGWVSQTLQKKVLVVS
VAEITFNRSMYSQLPGQEAFLRAQMELVLEKYEVYNPTPIIVGSSVGGLLLLALITAILY
KVGFFKRQYKEMMEGANGQTAPENGTGDPQVAQ
NT seq 3522 nt   +upstreamnt  +downstreamnt
atgtccatgtctgaccttccagtcatgaccaggaccaggattttcctcctcctgttgatg
gccctggcttcctctttctgcttcaacttggacatagaccagccaacaaccttccatgtg
aacagcgctgggtttggatacagcgtggtccagtatgccaactgggtggtggttggagcc
ccccaggagataaaggctgctgatcaaacgggcggcctctaccagtgcgactacagcgtg
ggcaagtgtgaacccatcctcctgccggtgcctccagaggctgtgaacatgtccctgggc
ctgtccatggtggccaccaccagcccctttcggctgctggcctgtggccccaccgtgcac
catgcatgcagggagaacatgcacttgaccgggttctgcttcctgctggcctccccgtcc
tggcaggcccagaggatcccggctgccctgcaggagtgcccgaggcaggagcaggacatt
gccttcctgatcgatggttcaggcagcatctccgccaccaattttgccaaaatgctgaac
ttcgtgaaggctatgatgaggcagttccagcgtcccagctcccagttctccctggtgcag
ttctcccacaagttccaggtgcacttcactttcaaagccttcgcagccagctcaaaccca
ctaagcctgnnnnnnnnnnnnnnnnnnnnnnnnctgaactccgtacagaagctgagtggg
tacacgtacacggccacagccatcaggagggtcacagaacagctgttcagtgccttatat
ggggcccgaaaagatgcctccaaaatcctcatcgtcatcactgacgggcagaaaaaatat
gaccctctggattacaaggatgtcattcccagtgctgaggctgctggcatcatccgctat
gcaattggggtgggattggcttttcaaaatatacattcctggcaagaattaaaggacatc
gcatcgaagccctcccatgaacatatatttaaagtggagaactttgatgctttgagagac
attcaaaaccaactgaaagagaagatctttgccattgagggtacgcagaccataagcagc
agttccttcgaactggagatgtcccaggagggcttcagtgctgtgttcatgcctgatgga
ccagttctgggggctgtggggagcttcagctggtctggaggtgccttcctgtacccccca
aataggagccccaccttcatcaacatgtctcaggagcacgcggacatgagggactcttac
ctgggttactccacagagctggccatttggaagggggtacacagcctggtcctgggggcc
ccccgccatcagcacaccgggaaggttgtcatcttcacccaggtgtccgggcaatggagg
ccgaaggctgaagtcacagggacccagatcggctcctactttggggcctccctcagctcc
gtggacgtggacagagatggcagctccgacctggtcctcatcggggccccccattactat
gagcagagccggggggggcaggtgtctgtgtgccccttgcctcaagcgagggctaagtgg
cagtgtggtgctgtcctgcgaggggagcaaggccacccctggggccgctttggggcagct
ctgacggtgctgggggatgtgaacggggacaggctgacggacgtggccatcggggccccg
ggagagcaggagaaccagggtgctgtctacctgtttcacggaacctcgggactgggcatc
agccccgcccacagccagcggatcacaggtgcccagttctcccccagcctccagtatttt
gggcagtcactgagcgggggtcaggacctcaccatggatggactggtggacttggctgtg
ggggcctgggggcacgcgctgctgctcaggaccagacctgtgcttagggtgtgggcaaac
atccgcatcacacctccagagatcaccaggtctgtgtatgagtgccaccagcagctggcc
tttgcccagtctctgggtgaggccattgtctgccttcgtgtttctcaaagtcccaagaac
cggctggctaacctccaaagcattgtgacctttgacctaacccttgaccctggccgcctg
agtcctcgtgctgtcttcgaggagacaaggactcggaacctgactcgtgttcgagacctg
gggctgacacagcactgcgagcctgtgaggttgctcctgccggcctgtgtggaggactcg
gtgacccccatcatcttgcgtctcaacttctccctagtgggcaagcctgtctctggcttt
ggaaacctccagcctatgctggcagtggatgcccagagatacttcatgacctctctcccc
tttgagaagaactgtggtgccgatcacgtctgccaggacgaccttggcatctcctttggg
gtctcaggcttgaagaccctgattgtggggagtaatctggagctgaacttggaagtgaga
gtgtggaatgatggcgaggactcctatggaaccacaatcaccttcttctactcgccgggg
ctatcttaccgacgtgtggcagggggccagctgcagtcacgttccctgcgcctgacctgt
gacagtgcccccaccaggagccagggcaccctcagcacccgctgtagcatcaaccactta
atcttccgtgagggcgcccagatcaccttcatggcaacctttgatgtctcccccacggcc
atgctgggagaccggctgcttcttgcagccaatgtgagcagtgagaataacacccccaag
atgagcaagaccaccttccggctggagctcccggtgaagtacgctgtctacaccgtgatc
agcagccatgaacaatccaccaagtacctcaacttctcggcctcggaggaggaggaaagc
agcggggctcagcacagataccaggtgaacaacctggggcagagggacctgcctgtcagc
attgacttctcagtgcccgtggagctgaaccggttggccgtgtggaaggatgtggatgtc
ctccaccctcagaacccatccattcagtgctcttcagagagaacagtgcccacagagtct
gacttcctgacccacttgcagaagaagcctgtcctggactgctccgttgctgactgcctg
aggttccgctgtgacatccgctccttcggcgtccaggaggaacttgacttcatcctgaaa
ggcaatctcagcttcggctgggtcagccagacactgcagaagaaggtgttggttgtgagt
gtagctgagatcacgttcaacagatccatgtattcccagcttccaggacaggaggcattt
ctgagagcccagatggagctggtgctggagaagtatgaggtctataacccaacccccatt
attgtgggcagctctgtgggaggactgctgctgctggctctcatcacagccatactgtac
aaggtcggcttcttcaaacgtcagtacaaggaaatgatggagggagcaaatggacagact
gctccagaaaatgggacaggagacccccaagtggcccagtaa

DBGET integrated database retrieval system