KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008406
Entry
103008406         CDS       T03086                                 
Name
(RefSeq) ras-related protein Rab-6C-like
  KO
K07895  Ras-related protein Rab-6C
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103008406
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:bacu04031]
    103008406
Membrane trafficking [BR:bacu04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    103008406
GTP-binding proteins [BR:bacu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    103008406
SSDB
Motif
Pfam: Ras Roc Arf SRPRB GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA CPT TetR_C_16
Other DBs
NCBI-GeneID: 103008406
NCBI-ProteinID: XP_007173772
UniProt: A0A383ZFB7
LinkDB
Position
Un
AA seq 258 aa
MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
TIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI
IMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQVFRRVAAALAGMEST
QDRSREDMIDIKLEKPQEQPVSEGGCSCXSPMAPSTFLQKLTALPPYSFIDCSVNIGLTL
LPSVITYCNSALLPVSWR
NT seq 777 nt   +upstreamnt  +downstreamnt
atgtccgcgggcggagacttcgggaatccgctgaggaaattcaagctggtgttcctaggg
gagcagagcgttggaaagacatcactgattaccagattcatgtatgacagttttgacaac
acctatcaggcaacaattggtattgactttttatcaaaaacaatgtacttagaggatcga
acaatcaggctgcagctatgggatactgcgggtcaggaacgtttccgtagcctcattccc
agttacatccgtgattctgctgcagccgtagtagtttacgatatcacaaatgttaactca
ttccagcaaactacaaagtggattgatgatgtcagaacagaaagaggaagtgatgttatc
atcatgctagtaggaaataaaacagatcttgctgacaagaggcaagtgtcaattgaggaa
ggagagaggaaagccaaagagctgaatgttatgtttattgaaactagtgcaaaagcagga
tataatgtaaagcaggtcttccgacgtgttgcagcagcactggctggaatggaaagcaca
caggacagaagcagagaagacatgattgacataaaactggaaaagcctcaggagcaacca
gtcagcgaaggaggctgttcctgctaatcccctatggcaccttcaactttcctccagaag
ctcactgctttgcccccttactctttcattgactgcagtgtgaatattggcttgaccctt
ctcccttcagtaataacgtattgcaattcagcattgctgcctgtctcttggagatga

DBGET integrated database retrieval system