KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017656
Entry
103017656         CDS       T03086                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04927  Cortisol synthesis and secretion
bacu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    103017656 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103017656 (MRAP)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 103017656
NCBI-ProteinID: XP_007183756
UniProt: A0A384A8S5
LinkDB
Position
Un
AA seq 189 aa
MANRTNASTAYYSYEYYLDYLDLIPVDENKLKANKHSIVIAFWVSLAAFVVFLLLLLLSM
SWSASPQTRNNAQHHPTCPWSLGLNLPFCVWKQPQHHRAPQGTPPPLPSSVEEPGGRASG
PVQQLQRGSPSTSAPLHPPGPPCSPLGTGPRWGPARHQLTSGTSSPVSLPCRQNLSMVEP
TTQTRAIAE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccaacaggaccaatgcctccactgcatactacagctacgaatactacctggactac
ttggacctcattcccgtggatgagaataagctgaaagccaacaaacattcgatcgtcatc
gccttctgggtgagcctggcagctttcgtggtgttccttctcctcctgctgctttccatg
tcctggtcagcctccccgcagacgaggaacaatgcccagcaccacccaacgtgcccctgg
agtctcggcctcaacctccccttctgtgtctggaagcaaccccagcaccacagggccccc
caggggaccccgccgcctctaccgagctcggtcgaggaaccaggtggcagagcatcgggc
cccgtccagcagctgcagcgggggagtccctctacctcggcccccctccaccccccaggg
ccaccctgctctcctctgggaactggccctcgatggggacccgcacggcaccaactgacg
tccggaacttcaagcccagtgagcctcccctgcagacagaacctctcgatggtagaacca
acaacccaaaccagggccattgctgagtga

DBGET integrated database retrieval system