KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018606
Entry
103018606         CDS       T03086                                 
Symbol
RIMKLA
Name
(RefSeq) ribosomal modification protein rimK like family member A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00250  Alanine, aspartate and glutamate metabolism
bacu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103018606 (RIMKLA)
Enzymes [BR:bacu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     103018606 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     103018606 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp CPSase_L_D2 Dala_Dala_lig_C Rimk_N Synapsin_C TTL
Other DBs
NCBI-GeneID: 103018606
NCBI-ProteinID: XP_007164722
UniProt: A0A383YPF8
LinkDB
Position
Un
AA seq 391 aa
MCSQLWFLTDRRILEDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGNLGLQLNQ
KALTTFPDVVLVRVSTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHVI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFTVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLSSPREKKEPDSCASAQGVTESVYAINSGSTSSESEPELGEIRG
SSASPAGAPAPMLPDPGYNINTRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatcctcgaggactaccctcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccatcgtcggcggcaacctcggcctgcagctgaaccag
aaggcgctcaccactttcccagatgtggtgcttgtccgggtgtccacaccctcagtgcag
tcggacagtgacatcaccgtcctgagacacctggagaagttgggctgccgcttagtcaac
cgcccacagagcattctaaactgcatcaacaaattctggacattccaggagctggctgga
catggggtccccatgccggacaccttctcctatggtgggcatgaagacttttcaaaaatg
atcgatgaagccgagccgctgggctacccggtcgtggtgaagagcacgcgcggacaccgg
ggaaaagctgtttttctcgcaagagataaacaccacctctcagacatctgccatgtgatc
cgccacgatgtgccctacctgttccagaagtacgtgaaggagtcccacggaaaggatatc
cgggtggtggtagtaggtggccaggtgataggctctatgcttcgctgctccacagacgga
cggatgcagagcaactgctctctcggtggcgtgggcgtcatgtgcccactgacagaacaa
ggcaagcagctggctatccaggtgtccaacatcctgggcatggacttctgtggcatcgat
ctcctcatcatggacgatggctcctttacggtgtgcgaagcaaacgccaacgtgggtttc
ctagcctttgaccaggcctgcaacttagatgtgggcgggatcattgcggactacaccatg
tccttgctgcccaacaggcagaccgggaagatggctgtcctcccaggactgtctagtccc
agggagaagaaagagccagacagctgtgcttcagctcagggagtcacagagagcgtctac
gccatcaacagcgggtctacctctagcgagagcgagcctgaactgggagagatccggggg
tcctcagcaagcccagcgggggccccagcccccatgctgcccgaccctggctacaacatt
aacaccaggattgcttcagaattaaaacttaagtga

DBGET integrated database retrieval system