KEGG   Bacillus atrophaeus: BATR1942_03280
Entry
BATR1942_03280    CDS       T01339                                 
Name
(GenBank) transcriptional activator protein Med
  KO
K05519  transcriptional activator of comK gene
Organism
bae  Bacillus atrophaeus
Brite
KEGG Orthology (KO) [BR:bae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bae03000]
    BATR1942_03280
Transcription factors [BR:bae03000]
 Prokaryotic type
  Other transcription factors
   Others
    BATR1942_03280
SSDB
Motif
Pfam: Bmp LPAM_2 Senescence
Other DBs
NCBI-ProteinID: ADP31612
UniProt: A0A0H3DZE9
LinkDB
Position
671666..672619
AA seq 317 aa
MITRLVMIFSVLLLLSGCGQTPFKGKIEKVGMLFPDTINDLVWGTKGYKGLLSIQSAYNV
DVYYKEGVKTDEDILNAIEDYHKRGINLLFGHGSEYEEMFNLVSEDYPDMEFVISNAESK
ADNVTSVHLNGEAMGFFGGMTAAHMSKTNQIGVIASFKWQPEVDGFIKGAKYENPDITIN
TKYTDHWDDDTTAVKLYEKIKEEGADVVYPAGDGYNVPVIQQIKKDGLYAIGYVTDQSDQ
GENTVLTSTVQNVDKAYGIIAEQYSKGTLESGDHYFDFKDHVVEMGTFSPLVDKAFQDKI
AALIKTYNQTDELPKKE
NT seq 954 nt   +upstreamnt  +downstreamnt
atgatcactaggcttgtcatgatcttttctgtcctcctgttactgagcggatgtggacaa
actccgtttaaaggaaaaattgagaaggtcggtatgctctttcccgataccatcaatgat
ctagtgtggggaacaaaagggtataaaggtttactaagtatacaatctgcatataatgtc
gacgtctactataaagaaggcgttaagactgatgaggatatattaaacgccattgaagat
taccacaagagagggataaaccttctttttggccatggcagtgaatacgaagaaatgttt
aatctggtcagtgaggattacccggacatggaatttgtcatttctaacgcggaatcaaaa
gccgacaacgtcacaagcgttcatcttaacggagaagcgatggggtttttcggcgggatg
acagccgcacatatgtccaaaaccaatcaaatcggcgtgattgcttcttttaaatggcag
cctgaagtagacggcttcatcaaaggggccaagtatgaaaatccggacatcactatcaat
acgaaatatacagaccactgggatgacgataccacagccgtgaagctttatgagaagata
aaagaggaaggcgcggatgttgtatatcccgccggagatgggtataatgttcctgtcatt
caacaaattaaaaaagacggtctctatgcgatcggctatgttacagaccagtctgatcag
ggcgaaaataccgttttgacaagcactgttcaaaatgtggacaaggcctatggcatcata
gccgagcaatacagcaagggcactttggaaagcggagatcactatttcgattttaaagat
catgtcgttgaaatggggacattcagtcctcttgtcgacaaagccttccaagataaaatt
gccgctcttatcaaaacgtataatcaaacagatgaactgccgaaaaaagagtaa

DBGET integrated database retrieval system