KEGG   Bacillus atrophaeus: BATR1942_07210
Entry
BATR1942_07210    CDS       T01339                                 
Name
(GenBank) plipastatin synthetase
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bae  Bacillus atrophaeus
Pathway
bae01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BATR1942_07210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bae01008]
    BATR1942_07210
Polyketide biosynthesis proteins [BR:bae01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    BATR1942_07210
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: ADP32392
UniProt: A0A0H3E1N5
LinkDB
Position
complement(1464995..1472653)
AA seq 2552 aa
MSQQSEIQDIYPLSFMQEGMLFHSLFDEQSRAYFEQASFTINGRLDLERFQKSMDAIVGR
YDIFRTTFIHKNVAKPRQVVLKSRPCRVQFEDISHLDKPDEEKYIETFRQQDKSKGFDLQ
TDVLMRVSILKSAPERYVCIWSHHHILMDGWCLGIVIKDFLHMYQALGEGRHPYLPPVQP
YGKYIKWLMRQDREEAAKYWKERLQDIEKTSSLPRKSVQTSEGKLQQAVFTISEQQTAGL
QQIAAASGATLSTVFQALWGLMLQRFNNSDDSVFGSVISGRPTELADVEGMVGLFINTVP
VRIQSGALSFSDLVRHMQKELLKAEAYSYFPLYDIQAQSALKQELIDHIIVFENVPTQQE
IEGLNQTGAFDFSVEDFSMAEETNYGCSIKVIPGSSLYVRINFHTDLYDTSMMEEIEGYM
QQMIASVIADPDIRASQIPLLNESKTRQIVSEFNKTEAVSPIAPTLHGLFTRQAALTPDR
PAIYFANGSLTYGELDTYSNRLAVRLAAKGVTKESIVGILAERSPEMMIAVLAVLKAGGA
YLPLDPAYPDGRLSYMLKDSGASLMLTQSGLTVPDFSGETLEVDMAALVDGNPSEVPAGT
ADSGSLAYLIYTSGSTGQPKGVAVEHRQAVSFLTGMQRQFPLHKEDVIVLKTSFSFDASV
WQLFWWTLSGASAYLLPSGWEKDPALMAEAFTQERVTTAHFIPAMLNSFLDQLEMETPER
RDELTTGLKRVFAGGEPLTPQAAARFADLLPETSLIHGYGPTEATVDAAFYVCDREKDSE
RLRLPIGKPVPGARLYILNPQMAVQPVGVIGELYIAGNGVARGYLNRPELTTERFLSDPF
YPGERMYKTGDLARWLPDGQVEFLGRLDDQVKIRGYRIEPGEIESALRNLEGVQEAAVIT
RTDSGEAELCAYIQGRDKNDVRAQLAHVLPGYMIPAHFVQINTWPITPSGKLDRKALPAP
DGAAGQESYKAPRNLTEMKLAQLWEDVLKNGPVGITDDFFDRGGHSLKATALISRIAKTF
GVQVPLKDVFARPTIEGLASVIRELEESPYAAIEPAEKRDTYPVSSAQKRMYVLQQLEDG
GTGYNMPAVLELEGKLDRKRLEAAFQALISRHESLRTSLETGNGGEPVQRIHHEVPFTVT
EENSADAFIRPFDLSQAPLFRAGLVRETNERHVLLVDMHHIISDGVSVNTLIREFGALYA
GRKLEPLRIQYKDYAVWQQEFKKGDTYEKQESYWLKQLGGELPVLELPTDKPRPAVRSFA
GDKISFTLDQEVTSGLNRLARENGSTLYMVLLAAYSALLSRLSGQEEIVVGSPIAGRPHE
DLEPVLGMFVNTLALRTRPEGGKGFTDYLQEVRQTALEAYEHQDYPFEELVEKLDVYRDT
SRNPLFDVMFALQNIGHENLMLEDLRLRSADIKHKVSKFDLTLYALEEPKGELRFHLEYN
TDLYKKKTVEQWLKYLIHIFREITEDHSVTLGKINIVDEDETRLIIHEFNRTKMEYPRHE
TVSRLFERQAAKTPDAAAVVSHGQTLTYHELNNRANRIAAVLRAKGVGPESVVALLTKRT
PELAAGILGILKAGGAYLPIGEDTPSERIEWMLSDSGAGILLQSEKLGNDFLNIEGEYEQ
IFIEAIQEQGNDTENLESLAGPDSLAYIIYTSGSTGKPKGVMIEQRSVIRLVTNSNYIEV
TPSDRLLMTSSFGFDVTTFEIFGPLLNGAALYMADKETFLDSHQLETYIHQNGITTLWLT
SPLFNHLTEQNENTFAGLSTLIIGGEALSASHVNRIRKACPSLAIWNGYGPTENTTFSTC
FEIERYYEHSIPIGRPIGNSTAYILNDWGMLQPIGTVGELCVGGDGVARGYLGRPELTKE
KFVPNPFAIGERMYRTGDLACWLPDGTIEYAGRMDEQVKIRGYRVELGEIETAIRHIDGV
KEAAVLARPGQSGSKELVAYMSLQADMDAEKVRSQLSRTLPGYMIPVYMIEMDALPLTAN
GKLDRKALPEPELSSKSKYVQPRSELEEQLALIWQEVLGLEKIGIEDSFFELGGDSIKAL
QVSARLGRYGWSMTASDLFRHPRIKDVSAVIRKTERVIDQGPVKGEVPLTPVQHWFLTQR
ITDRHHFNQSVMLFNSGRLIEKPLRETLQKLAKHHDALRMIYRKESGHVIQINQDIHETE
LYTLNASDFSDTEAWENEIEKEVAALQRGMNIEEGPLLRAGWFKTPSGDYLFLTIHHLVV
DGVSWRTLLEDLSAGYHQAAAGQSIQLPPKTDSYKEYAERLQDYAQSSKLIQEEAYWRSV
EEETIAALPYEKPQHNDTNDSSQNTVRFTLSEEDTTVLLQKVNHAYGTDTQDILLTAAAL
AIRDWTGESKLRIAMEGHGRENILPNVDISRTVGWFTSMYPVLLEIQKESGELGTAVKTV
KDTLGRIPQKGTGYGILKYITKPENKSIQFGGAPEIGFNYLGQFNDTEQQETFSLSGLAS
GEDITRSWQREQIIEISALAAENKLHFNLSYPPNRFYRKTMEHLLNGIQNYLQSIMKHCA
GKQETEKTLSDFSSKSLTMEDLDSISDLVQEL
NT seq 7659 nt   +upstreamnt  +downstreamnt
atgtcgcaacaatccgaaattcaggatatttatcccctgtcatttatgcaggagggcatg
ctttttcattcgctgtttgatgaacaatcaagagcctattttgaacaggcatcctttacc
atcaacggaaggctagacttggaacgcttccaaaaaagtatggatgccattgttggccga
tatgacatctttcgtacaactttcattcacaaaaatgtagccaagcctaggcaagtcgtg
ctcaaaagccgtccatgccgcgttcagtttgaggatatttcccatcttgataagccagat
gaagagaaatatatcgaaacctttcggcaacaagataagtccaaaggctttgatctgcaa
acagatgtccttatgagggtatccattttgaaatcggcacctgagcgctatgtctgtatt
tggagccatcaccatattttgatggacggatggtgcctcggcattgtcattaaagatttt
ctccacatgtatcaggccctgggcgaagggcgtcatccttaccttcctccggttcagccg
tacggaaaatatatcaagtggctgatgcggcaagaccgcgaagaggcggcaaagtattgg
aaagagcggcttcaagatattgaaaagacatcatccctgccaagaaaaagtgttcaaaca
tcagaaggaaaattacagcaggctgtatttacaatctcggaacagcaaactgccggatta
cagcaaattgcagcagcttccggggcgacgctgagcacggtttttcaagcgttgtgggga
ctgatgctgcaacgattcaataacagtgacgattctgtgttcggttctgtaatttccggc
agaccaacggagcttgcagacgtggagggcatggtcgggctctttatcaatacagttccc
gttcgcatccaaagcggagcgctttccttctcggatctggtcaggcatatgcaaaaggag
ttactgaaagcagaagcttatagttattttcctttgtatgatattcaagcgcaaagcgca
ctcaagcaggaactgatcgatcatattatcgtatttgaaaatgtgccgacacagcaggaa
attgagggattgaaccagaccggggcgtttgatttttcggtggaggacttttcgatggct
gaggaaaccaactacgggtgcagtataaaagtcattccgggatcctctttatatgtacgg
atcaattttcatacagatttgtatgacaccagcatgatggaagagatcgaagggtatatg
cagcaaatgattgcatctgttatcgctgaccctgatatacgcgcttcacagattccattg
ctaaatgaaagcaaaacacggcaaattgtttctgaattcaacaaaacagaagctgtttcg
cctatagctccgactctccacggcctgtttacacgccaggcggcgcttacgccggatcgg
ccggcgatttacttcgctaatgggagtctgacatacggggagcttgatacgtattcaaac
aggctggccgtacgccttgcggcgaaaggcgtgacgaaagaaagcatcgtcggcatcctt
gccgagcgctcgccggaaatgatgattgccgtgctggccgttttgaaagcgggcggcgct
tatctgccgcttgatccggcgtatcctgacgggcgcctgagctacatgctgaaagacagc
ggggcttctcttatgctgacacagtctggtttaacggttcccgatttttcaggtgagacg
cttgaagtggatatggcggcgcttgtggatggcaatccttcagaagtgcctgcaggcaca
gccgacagcggctctctggcgtatctcatttatacctccggctccacggggcagccaaag
ggcgtggcggtggagcatcgccaggcggtttcttttctgaccggcatgcaacggcagttt
ccgttacataaagaggatgtcattgtgctgaaaacgtcattttcatttgacgcgtctgtc
tggcagctgttctggtggacactctcaggcgcttcggcctatctgcttccgtccggctgg
gaaaaagatccggcgctcatggcagaggcattcacgcaggaacgtgtgacaacggctcac
ttcattcctgcgatgctgaacagcttcttagatcagctggagatggaaacgcctgagcga
agggacgagctcacgacaggtcttaagcgggtattcgccggaggcgaaccgctcacgcct
caagcagcggcccgatttgctgatctcttgccggagacgtctctgatccacggctacggg
ccgacagaagccacggtggatgcggcattttacgtgtgtgacagagaaaaagacagtgaa
cggctgcgtcttccgatcggaaagcccgtgccgggcgcgcgtctttatatcttgaaccct
cagatggctgttcagcctgtgggtgtcataggcgaactgtatatcgccgggaatggtgtg
gccagaggctacctgaatcgccccgagttaacgacggaacgctttctctctgatcccttt
tatcctggggaacggatgtacaaaacgggagatttagcgcgctggctgccggacgggcag
gttgagttcctcggccgtttggacgatcaagtcaaaatccgcggctaccggatcgaaccc
ggcgaaattgaatcagctctccggaacttggaaggcgtgcaggaagcagccgtcatcacc
cgcacagacagcggggaggcagagctatgcgcttatatccaggggcgtgataaaaacgac
gtgcgggcacagcttgcgcacgtgctgcccggctatatgatccccgctcattttgtgcaa
atcaacacatggccgatcacaccaagcgggaagcttgaccggaaggctttgcccgctcct
gatggagcggctggtcaagaatcatacaaggcaccaagaaatcttaccgaaatgaagctg
gcccagctttgggaagacgtgctgaaaaacggtcctgtcggtatcacggacgactttttt
gaccggggcggccactcgttaaaagcaacggcactgatttcacggatcgccaagacattc
ggcgtccaagtgccgcttaaagacgtatttgcccgaccgaccatagaagggctggcttct
gtcatccgcgagttggaggaaagcccgtatgcggcgatcgaaccggccgaaaagcgggac
acctatccggtctcctcggcgcaaaaacggatgtatgtccttcagcagctggaagatgga
ggcactggctacaatatgcctgcggtgctggagctggaaggcaagcttgaccgtaaacgg
ctggaggcggctttccaagcgctgatcagtcgccatgagtcgctccggacgtccttggaa
accggaaacggaggggagccggtccaacgcatccatcatgaggtgccgtttacggtgacc
gaagagaactcggcggatgcatttatacgcccttttgatctcagtcaggctccgcttttc
agagcgggactcgtaagagaaacaaacgagcgtcatgtcctattggtagacatgcatcac
atcatttctgacggcgtctcagtcaatacgctcattcgggaattcggggcattgtacgcc
gggcggaagcttgagccgctgcgcatccaatacaaagattacgccgtatggcagcaggaa
ttcaaaaaaggcgacacatatgagaagcaggaatcttattggctgaagcagctcggaggc
gagttgcctgtgcttgaactgccaacggacaagccccgtccggcggtgcgaagcttcgcc
ggtgacaagatctcatttactctggatcaagaagtcacgtccggcctgaaccgcctcgcg
cgagaaaacggcagcaccctgtatatggtgcttcttgcggcctactcagctcttttgtca
cgcctcagcgggcaagaggagattgtggtcggatcgccgatcgccggccgtccgcatgaa
gaccttgaacccgtgctcggcatgtttgtgaacacgttggcgcttcggacacgcccggag
ggcggaaagggtttcacagactatttgcaggaagtccgtcagacagcactggaagcctat
gaacatcaggattatccatttgaagaactggtcgaaaagctcgacgtttatcgagacaca
agccgcaatccgctgtttgatgtcatgttcgctcttcaaaacataggtcatgaaaatctg
atgctggaagatttgcgtctccggtctgctgatattaagcataaagtgtccaaattcgat
ttgacactttatgcattggaagaacccaaaggggagctccgttttcatctggaatataat
actgatttatacaagaaaaaaacagtagaacaatggctaaaatacttgattcatatcttc
cgggaaatcaccgaagatcattcagtaactctagggaaaatcaatatagttgatgaagat
gagacaagattaatcattcacgaattcaaccgtacaaaaatggaatatccaaggcatgaa
acagtcagccgcctttttgaaagacaagcggcaaaaacgcctgatgccgcagccgttgtc
agccatggacaaacattgacttatcatgaactgaacaatcgggcgaacaggatcgcggcg
gtgctccgggcaaaaggggtcggtcctgaaagtgtcgtagctttattgactaagcgcaca
ccagagcttgcggccggaatattaggaattttgaaagcaggaggggcttatcttcctatc
ggagaagacacgccgtcagaacgaatagaatggatgctgtcagatagcggggctggaatt
ctccttcaatcagaaaaactcgggaacgatttcttaaatatagaaggagaatatgaacaa
attttcatcgaagcgattcaagagcaaggaaatgatacggaaaaccttgaatcacttgcc
ggaccggattcacttgcctatatcatctatacatccggatcaactgggaaaccaaaagga
gtaatgattgagcagcgaagtgtcattcgtcttgtgacaaacagcaattatattgaggtt
acaccttcagaccggcttctgatgacttcttcttttggtttcgatgtaactacttttgaa
atattcgggccgctacttaatggcgcagccctatatatggccgacaaagaaacgttcctt
gattcccatcagcttgagacatacatacaccaaaacggaatcacaacattatggctgact
tcacctctttttaatcatttgaccgaacagaatgagaatacgtttgccggtctgtccaca
ttgatcataggcggtgaggctttatctgccagccatgtcaatcggattcggaaagcctgt
ccgtcactggcaatatggaatggatatgggccgactgaaaatacgacgttctcaacctgc
tttgagattgagagatactacgagcattcaataccgattggccgtccgattggaaattca
acagcttatatattaaacgactggggaatgcttcagccgattggaacagtcggagaatta
tgtgttggcggtgatggagtagcaagaggctatcttggccgtcctgagttaacaaaagaa
aaatttgtgcctaacccttttgcaattggcgaacgaatgtaccgaaccggcgatttagcc
tgctggctgccggatggaactattgaatatgccgggcgtatggacgagcaggtgaaaatc
cgcggctaccgggtcgagcttggtgaaatagaaacagcgattcggcatatagacggagtc
aaggaagctgctgtattggcgcgcccgggacagtctggaagcaaagagttagtcgcatac
atgagtttgcaagcggatatggatgctgaaaaagtacgttcacagctttcccgcacatta
ccgggatatatgatacctgtatatatgattgaaatggacgctcttccgctgaccgcaaac
gggaaactggacagaaaagcgctccctgaaccggaactctcatcaaaatcaaagtacgta
cagccgcgaagtgagcttgaagaacagcttgcgctgatatggcaggaagtgcttggcctt
gagaaaatcggaattgaggattcgttttttgaactgggcggagattcaatcaaagctctt
caagtatctgcacgtcttggccgttacggctggagtatgacggcaagcgatttattccgg
cacccgagaatcaaagatgtatctgctgtaattcgcaaaacagaaagagtgattgaccaa
gggccggtgaagggcgaagttccattgacacctgtccagcactggttccttactcaacgt
ataacagacagacaccatttcaatcagtctgtgatgctctttaactccggcagattgata
gagaaaccgctgcgggagactttacaaaagcttgcgaaacaccatgacgcacttcgtatg
atataccgcaaagagagcggacatgtaatacaaatcaatcaagatattcatgaaacagaa
ttgtacactttgaacgcctcagatttttcagatacagaagcttgggaaaatgaaattgag
aaagaagtcgcagctcttcaaagagggatgaatatagaagaaggaccgttgttaagagca
ggctggtttaaaacgccttcgggagactatttgttcctgacaattcaccatctagtcgtt
gacggggtatcgtggcggactttgcttgaagatttgtctgccggctatcatcaagcagcg
gcggggcaatccattcagcttccgcccaagacagattcatataaggagtacgcagaacgc
ctccaagattacgcgcaaagcagcaagctgattcaagaagaagcttattggcgttctgta
gaagaggaaacaatagcggcactcccatatgaaaagccgcagcacaatgatacaaatgac
agcagtcaaaacacagtgcgctttacactttctgaagaagacacgaccgtcctgcttcaa
aaagtaaatcacgcttatggcacagatacacaagatattctgcttacggcagcagcatta
gcgattcgggactggaccggggaaagcaaacttcggattgcgatggagggacacggaagg
gaaaacatactccctaatgtggatatcagccgcacagtcgggtggttcacctcaatgtac
ccagtgcttcttgagattcaaaaagagtcaggcgagttgggaactgcggtgaaaacagtg
aaagatacgcttgggcgaatacctcagaaagggaccggatacggcattttgaaatatata
acaaagccggagaacaaaagcatacagtttgggggagctcccgagatcggatttaactac
ttagggcaattcaacgatacagagcagcaagaaaccttcagcttatcagggcttgcaagc
ggggaggacatcacacgctcatggcagcgtgagcaaataatagagatcagtgcattggcg
gcggaaaacaaactgcactttaatctcagctatccgccaaaccgattttacagaaaaacg
atggaacatcttttgaacgggattcaaaactatttgcaaagcattatgaaacattgcgca
ggcaaacaggagacagaaaagacattgagcgatttcagcagtaaatcgttgacaatggag
gatttggacagcatttccgacttagttcaagaactgtag

DBGET integrated database retrieval system