KEGG   Bacillus atrophaeus: BATR1942_12885
Entry
BATR1942_12885    CDS       T01339                                 
Name
(GenBank) cytochrome P450 for pimelic acid formation for biotin biosynthesis
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bae  Bacillus atrophaeus
Pathway
bae00780  Biotin metabolism
bae01100  Metabolic pathways
bae01240  Biosynthesis of cofactors
Module
bae_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BATR1942_12885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bae00199]
    BATR1942_12885
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BATR1942_12885
Cytochrome P450 [BR:bae00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BATR1942_12885
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ADP33504
UniProt: A0A0H3E6Y2
LinkDB
Position
complement(2520464..2521663)
AA seq 399 aa
MTIKNLTIPVSLSSSEFFENPYPFYDKLRSIHPIYKGNFLKYPGWYVTGYAEAAAILKDT
RFKNRIPLPENSQKYSELKNMQHHMMLFKNPPDHKRIRMMVSRAFTPRFAESYRPYINET
VNVLLNEVQYKRTMDVVSDFAFPLASLIIAKMLGVPAGESYQFREWAASLIQTIDFTRSR
KELTKGNDKAIKLIAYFKDLIQQKKHNPQNDLISMLMKEQQDERLSDEELLATCILLVIA
GHETTVNLISNSILSLLNHPEKLMELKEKPSLIESAVEEFLRYESPTQMTARVASEDIEM
NGMMIKKEEHVYILLGAANRDPKKFTHPHVLDITRNPNPHLAFGQGIHFCLGSSLARLEA
QIAICTLLQRIPNLQLSTPNVQYRKLIGFRSLTELPVTF
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgacaattaaaaatctaacaatccctgtttcactttcttcttctgagttttttgaaaat
ccatatcctttttacgataagttgcgttctattcatccaatatataaggggaatttctta
aaatatccggggtggtatgtaacaggatatgcagaggcggcagcgattcttaaagatacc
agatttaaaaatcgcatcccgctcccagagaactcacaaaaatatagtgaacttaaaaat
atgcagcaccatatgatgctgtttaaaaatccacctgatcataaacgtatacgcatgatg
gtgagcagagcatttactccaagatttgcagaaagctatcgtccttatataaacgaaact
gttaatgttttgcttaatgaagtgcaatataagagaacaatggatgttgtttcagatttt
gcttttcctttagcaagcctcattatagctaagatgttaggagtaccggcaggagagagt
tatcaatttagagaatgggctgcaagcttaattcaaacaattgattttaccagatccaga
aaggagttaacaaagggtaacgataaggctataaagttaatagcgtatttcaaagatctg
attcaacagaaaaaacataaccctcaaaatgacctcatcagcatgttaatgaaggagcag
caagatgagaggttatcagatgaggaattactggcaacatgtatattgctcgtcattgcc
ggacatgagacaacggtaaatctcatcagcaattcgatcctttccttattaaatcatcca
gagaagctaatggaactaaaggaaaagccatcgcttattgaatcggcagtcgaggaattt
ttacgttatgagagccctacacaaatgacagctcgtgttgcatctgaagatattgaaatg
aacggaatgatgattaaaaaagaagaacatgtatatatccttttaggtgctgctaatcga
gatccgaaaaaattcactcatcctcatgtgcttgatattactagaaatccaaatcctcat
ctcgcatttggacagggcattcatttttgtttaggttcctcattggcacgtttagaagcg
caaatcgcgatttgtacactgctgcaacgaatccctaaccttcaactgtctactcctaac
gtgcaatatcgaaagcttattggttttagatcattgacagaacttccggttactttttaa

DBGET integrated database retrieval system