KEGG   Brevibacillus agri: BA6348_06760
Entry
BA6348_06760      CDS       T05855                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bagr  Brevibacillus agri
Brite
KEGG Orthology (KO) [BR:bagr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bagr03000]
    BA6348_06760
Transcription factors [BR:bagr03000]
 Prokaryotic type
  Other transcription factors
   Others
    BA6348_06760
SSDB
Motif
Pfam: Bmp Peripla_BP_4 Peripla_BP_6
Other DBs
NCBI-ProteinID: QAV12490
LinkDB
Position
complement(1360437..1361447)
AA seq 336 aa
MLKLKPFFALFTALVVGLLLLITSQFITSMKHLEEVMNERGPSSDILRVALLLEGPTYDQ
GWNSSAMESITEMQKRFGFSLEIANNLKPEQIMNVAQKYAANDYDLILGHGVIFSEPFTR
VALQYPHTRFVSFNGEAPHPNQTTIRYDMKPAGKLVGMLAAKMSRARKVGYILVDKPPEL
AQAEGFREGVKKVSPKTEVVIGKVSDFNDIENAVQKTREMIARGVDVIYTTGDSFNLAVI
TEAQRAKVYTIGYIADQRYIAPDYVLASLVQDVRQCYRIILEQYMAGRLPSGKVVYGLAE
GVNHFSPFGPMVPPEVREDIEREMQRLTSSRGSFGG
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgctcaagctgaagcctttttttgccctgttcaccgctttggttgtcgggctgcttctg
ctcattaccagccagttcatcaccagtatgaagcatttggaagaggtcatgaatgaacgc
gggccttcttctgacatattgcgtgtggccttgctgctggaaggtcctacctacgaccag
ggctggaacagcagcgcgatggaaagcatcacggaaatgcaaaaaagattcggcttttcc
ctggaaatcgcgaacaatttaaagccggagcaaattatgaacgtggcgcaaaaatacgcc
gccaatgactacgatctcatcctgggacatggcgtgattttttccgaaccgtttacccgc
gtggcgctgcaatatccgcatacccgctttgtttcttttaacggggaagccccgcatccc
aaccagacgacgattcgctacgacatgaagcccgcaggcaagctcgtcggcatgctcgca
gcgaaaatgtcccgcgcccgcaaagtcggctatattttggtggacaaaccgccggaactt
gcccaggccgagggctttcgcgaaggggtaaaaaaggtttccccgaaaacggaggtcgtg
atcggaaaagtgtcagattttaatgacatagaaaatgcggtgcagaagacacgcgagatg
atcgcccgcggcgtcgatgtcatctacacgaccggcgacagcttcaacctcgccgtcatt
accgaagcgcagcgggccaaggtgtacaccatcggctacatcgcggaccagcgctacatt
gcgccggactacgttctcgcctcgctggtgcaggacgtgcgccagtgctaccggattatt
ttggagcagtacatggcaggccggcttccgagcggcaaagtcgtgtacggcctggccgaa
ggcgtgaaccatttcagcccgttcggcccgatggtgcccccggaagttcgtgaagatatt
gaacgggaaatgcagcgtctcacttcttcccgtggttcatttggaggttaa

DBGET integrated database retrieval system