KEGG   Bacillus altitudinis: CFN77_05620
Entry
CFN77_05620       CDS       T05199                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
balt  Bacillus altitudinis
Brite
KEGG Orthology (KO) [BR:balt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:balt03000]
    CFN77_05620
Transcription factors [BR:balt03000]
 Prokaryotic type
  Other transcription factors
   Others
    CFN77_05620
SSDB
Motif
Pfam: Bmp Peripla_BP_4 PP_kinase_C_1 Glyoxalase
Other DBs
NCBI-ProteinID: ATH71688
LinkDB
Position
1118890..1119855
AA seq 321 aa
MKYQRLVMIFSFLLLMLSACSQAPLKGHIEKVGLLVPDTINDQVWGTKGYKGLLNIQSTF
GVDVYYKEGMVDKEKIVDAIEEFHKKGVNLIIGHGNEYSEIFNLISEDYPKTQFITVNGG
KPQADNVTNVTFKGEAMGFFGGMTAAHMSKTKKIGILATYDWQSEVDGFIKGAKYQDEHV
QVLAEFVENWDDADKAVNLYQKLKKQGVDVVYPAGDGYNIPVIEQIKTDNLSAIGYVTDQ
SNLGSHTVLTSTVQHVDKAYSIIAKKFNEGKLNEQGEYSFDFKEGVIEMGKFSSTIDRAF
VKDIEKDIANYKKTGKLPNEK
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaagtaccagcggcttgtcatgatcttttcgttccttcttcttatgctatctgcctgc
tcgcaggcgccgttaaaaggacatattgagaaggtgggtttactcgtccccgatacgatt
aatgatcaagtttggggaacgaaaggttataaaggcttattaaatatccaatcaacattt
ggtgtagatgtttattataaggaagggatggtcgacaaggagaaaatcgttgatgccatt
gaagaatttcataaaaaaggagtcaatttaattattggccatggcaatgaatacagcgaa
attttcaacttgatcagtgaagattatccgaaaacacaatttatcacggtcaatggaggc
aagcctcaagctgataatgtcacaaacgtcacgtttaaaggagaagcaatgggctttttc
ggaggcatgacagcagcacatatgtccaaaacaaaaaagattggtattctggctacatat
gattggcaaagtgaagtagacggttttatcaaaggtgcaaaatatcaggacgaacatgtg
caagtcctagcggaatttgtcgaaaattgggatgatgctgacaaagcggtgaacctctat
caaaaattgaaaaaacaaggtgtagatgttgtgtatccagcaggtgatggttataatatc
cctgtcattgaacaaatcaaaaccgacaatctatctgcgatcggatatgtcactgatcaa
tccaaccttggaagccatacggtgttaactagcactgtacagcatgtcgataaagcgtac
agtatcattgcgaaaaagtttaatgaaggcaagctaaacgaacaaggtgagtactccttt
gactttaaagaaggagtgatcgaaatggggaaatttagctcaaccatagaccgcgctttt
gtgaaagacattgagaaggatattgcgaattacaaaaaaacaggcaaattgccaaatgaa
aagtga

DBGET integrated database retrieval system