KEGG   Bacillus velezensis UCMB5033: RBAU_1799
Entry
RBAU_1799         CDS       T02795                                 
Symbol
bioI
Name
(GenBank) cytochrome P450 for pimelic acid formation for biotin biosynthesis
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama00780  Biotin metabolism
bama01100  Metabolic pathways
bama01240  Biosynthesis of cofactors
Module
bama_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bama00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RBAU_1799 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bama00199]
    RBAU_1799 (bioI)
Enzymes [BR:bama01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     RBAU_1799 (bioI)
Cytochrome P450 [BR:bama00199]
 Cytochrome P450, bacteria type
  CYP107 family
   RBAU_1799 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: CDG29767
UniProt: S6FXT4
LinkDB
Position
complement(1955262..1956458)
AA seq 398 aa
MTADLSIVHPSLHADSDFWNDPYPFYDKLRSIDPVYKGTVLKYPGWYVTGYKEAAAILKD
IRFKNRIPLPEASTKYQNLSHIQHDMLLFKNQSDHKRMRMLIGKEFTAKTAESLRPCIKE
TVHDLLDQVQIKKTADLVSEFAFPLASLIIAEILGVPKEERYQFRQWTADVIQAIDLTRS
RKTLVRASDTAGRLTSYFKDLIHKRKAHPQQDLISRFIMEEQLSKEEVLATCILLVIAGH
ETTVNLISNGVFTLLKHPEQLSALRENPSLIETAVEECLRYDSPAQLTARTASEDCEING
KTIKKGEQVYILLGAANRDPSIFDQPHKMDIQRKPNPHLAFGKNAHFCIGSSLARIEAQI
AILTLFERMPKLRLAAHRLEYRKLIGFRSLKELPVVIG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcggacctatcgattgtacatccgtctctccatgcggattcggatttttggaat
gacccttacccgttttatgacaaactgcgatccattgatcctgtttataaaggaaccgta
ttaaaatatccgggctggtatgtcaccgggtacaaagaagcggcagcgattctgaaagac
attcggtttaaaaaccgcattcctcttccggaagcttcaacgaaatatcaaaatctatcg
catatccagcacgatatgctgttatttaaaaatcaatcagaccataagcggatgcggatg
cttatcggtaaagaatttaccgcaaagacggcggaatcacttcgcccttgtataaaagaa
acggttcatgacttgttggatcaagtccaaatcaaaaaaaccgcggaccttgtttcagag
tttgcctttccattggcaagccttatcattgcggagatactcggagtgccgaaagaggag
agatatcaattcagacaatggacggcagacgtcatccaggccattgatcttacccgatca
agaaagacgttagtcagagcaagcgacaccgcaggcaggctgacgtcatatttcaaagat
ttgattcacaagcggaaagcgcaccctcagcaagacttgatcagcaggtttattatggag
gaacagctttcaaaagaggaagtgctcgcgacatgtatcttacttgtcatagccggacac
gagacgacggtaaacctcataagcaacggtgtgtttactttattgaaacaccctgaacag
cttagcgcactgagagaaaacccctcgcttattgaaactgcagttgaggaatgtctgcgc
tacgacagccccgcgcagctgacggcacgcaccgcctcagaagactgcgaaataaatggg
aagaccataaaaaaaggagagcaggtatatatccttttaggggcagccaatcgcgatcca
agcatattcgatcaacctcacaaaatggatatccaaagaaagccgaacccgcatcttgca
ttcggaaagaacgcccatttttgcataggctcctcattagcgcgcatcgaagcacaaatt
gcaattcttacactgtttgagcggatgcctaagcttcggctggctgcacaccgccttgaa
taccgcaagctcattggttttaggtcgctcaaagagctcccggttgtcattggctga

DBGET integrated database retrieval system