KEGG   Bacillus velezensis UCMB5033: RBAU_1819
Entry
RBAU_1819         CDS       T02795                                 
Symbol
fenC
Name
(GenBank) FenC protein
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bama00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    RBAU_1819 (fenC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bama01008]
    RBAU_1819 (fenC)
Polyketide biosynthesis proteins [BR:bama01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    RBAU_1819 (fenC)
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Cas5fv_helical
Other DBs
NCBI-ProteinID: CDG29787
UniProt: S6FXU5
LinkDB
Position
complement(1988277..1995911)
AA seq 2544 aa
MENTVYSLTHAQRRVWFTELLEPGTSICNLAACVKFRGDIDFDVLRHALDFSISQNDSLR
FQLTEGDGSEPQLYLAGHRPISLETVDFTHTDQAERDAWIDTQTRVPFKLFHSPLYQFTL
LVMSDEEVWLYSKFHHIIMDGISLNLLGNQLIDIYQKIMRSEDLTEHHRPSYLSYMEKEQ
QYLQSSRFQKDRSFWTETYRTVPEHLSLAERTSHLRQSTAASRDTITLSHSLEQSIRRFC
KENNISIISLFMASLYICISRLTAKKDIAIGTYYGNRGSRLEKDMLGMFVSTLPIRMTAD
PDAEFLSFVRSVGKEQLSVMRHQKYPYNLFVNELRQTHHDLQNIIGISMQYQPLEWRKAD
GFDYETAMFFSGHTANELSILIKERTDTGLIELNFDYQSALFTEKSIKRIQTHLLTIVEN
AVRNPNRLIRHIDMADENEKKRVLSAFNRTEAVEPPAPTLHGLFARRAAPSPHRPALRFP
GGMLTYAELDQYTDRLAVRLRQKGVRKESMVGVLAERSPEMVVSVLAVLKAGGAYVPLDP
EYPEDRLRYMLDDSGACLLLAQPGLSVSGFSGETLEVSLSALTGETETGAVSEEADSDSL
AYIIYTSGSTGTPKGVAVEHRQATAFLSGMQGQFPLTEEDIIVLKSSFSFDASIWQLFWW
TMSGASVYLLPAGWEKDPVRMIEAFVSEKVTTAHFIPAMVNSFLDALETEPAETRKRLGR
TLTRVFAGGEALSPLTAARFADLLPETVLIHGYGPTEATVDAAFYVCDRKRDSGRTRLPI
GKPVPGARLYVLDSGGTIQPAGVAGELYIAGTGVARGYLNRPELTEERFLDDPFYPGERM
YQTGDIARWTEDGLVEWLGRSDGQVKVRGYRIEPGEIEAAIRRIDGIREAAVTARTEHGE
TALYAYIEGRESDDVRAELATRLPAYMMPAQFIEMSEWPVTPSGKLDRRALPAPGGAADR
QAYTAPRNVTEMKLCALWEEVLKNGPVGIRDHFFERGGHSLKATALVSRIAKEFGVQVPL
QDIFARPTVEELASVIQDLEESPYEAIQPAQTQDTYPVSSAQKRMYVLQQLEDGGVGYNM
PAVLELTGPLDRGRLKETFRRLVERHESLRTSFETGPDGEPVQRIHDSVPFQLDEAESAD
AFVRPFCLEEAPLFRAALVKESDERHLLLTDMHHIISDGVSVNTLIKEFGELYAGRSLAP
MRLQYKDYAVWQRSFQEKEGYQKQEAYWLKRLEGELPVLELPADKPRPAVRSFAGGSVSC
TLDAETASGLHRIARDHGSTLYMVLLAAYNTLLARLSGQEDIIVGSPIAGRPHKDLEPIL
GMFVNTLAIRTEPKGDKRFTDYLAEVRQAALEAYEHQDYPFEELVERLGVQRDTSRNPLF
DVMFVLQNMERESLVLNKLHLAQAADTSHKTAKFDATLYASEGSDGSISFDFEFNTDIYQ
KQTIEKWLSYFTRILTKVIENQAIPLGDIHVLDDAETNRVIYQFNQTKSDYPRHETISRL
FERQAKETPDARAVVYDGQILTYRELNERANRIAAALRSNGVGPESVVALLTGRTTELAS
GILGILKAGGAYLPIGDDVPRERAEWMLKDCKADILLQSDKLDGLPLSGKRLFIEDIQTK
AGLSSENPEPLGGPESLAYMIYTSGSTGAPKGVMIEQRSVIRLVKNSNYIDFTPEDRLLF
TSSLGFDVTTFEIFGPLLNGASLYVSDQETYLDSDVLETFIQQNGITTLWLTSSLFNHLS
EQNEHVFSGLSRLIIGGEALSPSHVNRVRNALPHLSVWNGYGPTENTTFSTCFLIEQSYD
HSIPIGRPVGNSTAYIINSRGTPQPIGVIGELCTGGDGVARGYFGRPELTEEKFVPNPFV
PGERMYRTGDLARWLPDGTIEYAGRMDDQVKIRGYRVELGEIEATLRSLDGVKEAVVSVR
TGQSGNKELIAYMSLQADMDTEKVRSSLSKQLPNYMVPAYMMELEKLPLTPNGKLDRKNL
PEPELALQTAYTAPRNELEEQLSVIWQEVLGTKQVGIEDSFFELGGDSIKALQVSARLGR
YGRKMTASDLFRHPSIKELAPLIRKAERVIDQRQVEGDIPWTPVQHWFLSQRMENRNHFN
QSVMMFSSDALHKQPLKEALEHLVIHHDALRITVSAENESFRQINHGIQKDELYSLDIWD
LSETDTWEKEIESEVAALQQRMDIEKGPLLKAGWFKTRSGDYLFITVHHLAVDGVSWRIL
LEDLSAAYTQAVKGQPVQLPPKTDSFKQYAERLSEYAKSSKLMREEEYWRFIEEETAAEL
PYEKPQHQTGADSIRQTVSFTLTEEETSVLLQQVNRAYHTDTQDILLTAAALALRDWTGG
GRLRIAMEGHGREHIMPELDISRTVGWFTSMYPVLIDLNTAGAELGTAVKTVKDTLGRIP
DKGIGYGILKYMTPPEQKTIRFRQAPEISFNYLGQFNDTEDQHTFSLSGLASGHDITPTW
QREQAVEMSAMAAQNKLHFSLSYPPSRFRKETMEQLLQTLQQYLRDIMAHCTGKEEAEKT
VSDFSSKTLTSDDLDSIASFVEEL
NT seq 7635 nt   +upstreamnt  +downstreamnt
ttggagaacactgtttattctttaactcacgcacaaagaagagtgtggtttacggagctg
ctcgaaccgggcacaagtatctgcaatctcgcggcatgcgtcaaattcaggggggacatc
gattttgacgtactgcgccatgctttagatttttctatctcgcaaaatgattcgctcagg
tttcaactgacagaaggggacggatcagaaccccagctgtatcttgcggggcatcggccg
atttctctagagactgttgattttactcatactgatcaggcagagcgggacgcatggatt
gacacgcagacccgtgttccgttcaagctgtttcattcacctctgtatcaatttactctg
cttgtcatgtcagacgaagaagtttggctttattcaaaatttcaccatattatcatggac
ggcatctcgctcaacctgctcggcaaccagctcattgatatctaccaaaagatcatgcgg
agcgaggatttaactgaacaccacagaccttcctatctcagctacatggaaaaagaacag
caatacttacagtcttcccgttttcaaaaagaccgttcattttggactgaaacataccga
accgttccggaacacctttcactggcggaacgaacctctcatcttagacaaagcactgcg
gcttccagagatactatcactctttctcactccttagaacaatctatccggcgtttttgc
aaagaaaataatatcagcatcatctctctgtttatggcttcgttatacatatgcatcagc
cgtctgacggctaaaaaggatattgccatcggcacttattacggaaaccggggctccagg
ctcgaaaaggatatgctcggcatgttcgtcagcacactgccgatcagaatgacggcagat
cctgatgcggagttcctgtcctttgtccgcagcgtaggaaaagagcagctgtctgttatg
cggcaccagaaatatccttacaatctttttgtgaatgaattaaggcagactcatcatgac
ctgcaaaatatcatcggtatttcgatgcagtatcagccgcttgagtggcgtaaggcagac
ggtttcgattatgaaacggccatgtttttcagcggacataccgcaaacgagctatccatt
ttaattaaggagcggacagatacgggattgattgagctgaattttgattaccaatccgct
ttatttactgaaaaatcgattaaacgtattcaaactcatttgctgacgatcgttgaaaat
gccgttagaaatcctaaccggctgattcggcatattgatatggcggatgaaaatgaaaag
aaacgggtgttatctgcgtttaaccgtacagaagcggttgaaccgccggctccgacgctt
cacgggctgtttgcccgccgtgccgcgccttcgccgcatcgtccggcgctccgttttccg
ggcggcatgctgacgtacgccgagctcgatcagtacacggacaggctcgccgttcggctc
cgacaaaaaggcgtccgcaaagaaagcatggtcggcgtgctcgctgaacgttcgccggag
atggtggtttcagtgcttgctgtgttaaaagcgggcggcgcctacgtgccgcttgacccg
gagtatcctgaggacaggctgcgctatatgctcgatgacagcggggcttgtctcctgctt
gcacagccgggattatccgtttccggtttttccggagaaacgctagaagtgtctctttct
gctctgacaggcgagacggagacaggggctgtctctgaagaagcggatagcgattcgctc
gcttatatcatttatacgtccggttcgacgggaacaccgaagggagtggctgttgaacac
cgtcaggccaccgcctttttatcagggatgcaagggcagttcccgttgacagaagaggat
attatcgtgctgaaatcatccttttctttcgatgcttccatctggcaattgttttggtgg
acgatgtccggcgcgtccgtgtatctgcttcctgccggatgggagaaagatcctgtgcgg
atgattgaagcgtttgtctcagaaaaggtgacgaccgcgcattttattccggcgatggtc
aacagctttttagacgcactggaaacagagcctgcggaaacaagaaaacgcctcggcaga
accttgacacgcgtgtttgccggaggggaagctctttccccgcttacggctgcccggttt
gccgatcttctgccggagaccgtgctcattcacggctacgggccgacggaagcgacggtg
gatgcggcgttttacgtctgtgaccgaaaacgggacagcggacggacgcggcttccgatt
ggtaaacccgttccgggtgcccgtctgtatgtattagatagcggaggaaccatccagcct
gcgggcgtggcaggagagctgtacatcgcggggacaggggtggcccggggctatctgaac
cggcccgagctgacggaggagcgttttctcgatgatccgttttatccgggagagcgcatg
tatcagacgggcgatatcgcacgctggacagaagacggcctagtcgaatggctcggacgt
tcagacggacaggtgaaagtccgcggctaccggattgaaccgggagagatcgaagcggcg
atccggcgcatcgacggcattcgtgaggcggcagtcaccgcccggaccgaacacggcgaa
accgcgctttacgcctatatcgaaggacgggaaagcgatgacgtgcgggcggagcttgcg
acacgccttccggcctacatgatgccggctcagtttatagagatgagcgaatggccggtc
acgccgagcggaaagcttgaccgccgcgcgctgccggctcccggcggagcggcagacaga
caggcgtacaccgccccgcggaacgtcacggaaatgaagctttgcgccctttgggaagag
gtgctgaaaaacggccccgtcggcatccgggatcacttttttgagcggggcggccattcg
ttaaaagcgacggctctcgtctcccgcatcgccaaagagttcggtgttcaggtgccgtta
caggacatcttcgcccggccgacggtggaagagctcgcttcggttattcaggacttggaa
gagagcccgtatgaagcgattcagcctgcgcaaacacaggacacctatccggtgtcttcg
gcgcagaaacggatgtatgtgctccaacagcttgaagacggcggtgtcggctacaatatg
ccggctgtgctggaactgacgggcccgctcgatcgcggccggctgaaggagacgttccgg
cggcttgtggagcggcatgagtcgctcagaacgtcctttgaaacggggcctgacggcgaa
ccggtgcagcgcatccatgacagcgtaccgtttcagctggatgaggccgagtcagctgac
gcattcgtccggccgttttgtctggaggaagcgccgctcttccgtgcggccctcgtgaaa
gaatcggacgaacgtcatcttttattaacggatatgcatcatattatttctgacggtgtg
tccgtcaacaccttgattaaagaattcggcgagctgtacgcaggccgttcgcttgcgccg
atgcgccttcaatataaagactatgccgtctggcagcggtcatttcaggagaaagaaggg
taccagaagcaggaagcctattggctgaagcggcttgaaggagagcttccggtgcttgag
cttccggctgacaagccccgtccggctgtcagaagctttgcgggcggcagcgtatcgtgc
acgcttgacgctgaaacggcatccggccttcaccgcatcgcccgggatcacggctccact
ttgtatatggtgcttctcgccgcgtacaatacgttactcgcgagattgagcgggcaggaa
gacatcatcgtcggctcgccgattgccgggcgtccgcacaaagaccttgaaccgattctc
ggcatgttcgtcaacacgctggccatcagaacggagccgaaaggagacaaacggttcacc
gattacttggcggaagtccgccaggcggcgcttgaagcgtatgagcatcaggactacccg
tttgaagagctggtggagcggctcggcgtgcagcgggacacaagccgcaatccgctgttt
gacgttatgtttgtgctccaaaatatggagcgtgaatccctggtgttaaataagctgcat
ttggctcaagctgcggatacaagtcataaaaccgcaaagtttgatgccacgctttacgcg
tcagaagggtctgacggttccatcagctttgattttgaattcaatacagatatctatcaa
aaacagacaattgaaaaatggctttcttattttacccgtattcttacaaaagtaattgaa
aaccaagcgataccgcttggtgacattcacgtactggatgatgctgaaacaaatcgcgtc
atttatcagtttaatcagacgaaaagcgattacccaagacacgaaaccatcagccgttta
tttgagcggcaggcaaaagaaacccccgatgcccgggcagttgtatatgatggacaaatc
ttgacataccgtgagctgaacgaacgggctaacagaatagcggcggctctccgatcaaat
ggcgtcggtccggaaagcgttgtcgcattattaaccggccgcacaacagagcttgcttcc
ggaatcctcggaatattaaaagcggggggcgcctacttgcctatcggtgacgatgtgccg
cgggaacgggctgaatggatgcttaaagactgtaaagctgatattcttctccaatctgat
aaacttgacggtctgccgctttcaggaaaacgtttattcatagaggatattcaaacaaag
gccggcttgagttcggaaaatcccgaaccgctcggcggacctgaatcattggcctacatg
atttatacgtccggatcaacaggtgcgccaaaaggcgtcatgattgaacagcgaagcgtg
atccgccttgtgaaaaacagcaattatattgattttacgccggaagacagactattgttt
acttcatcattaggatttgatgttacgacatttgaaatattcggtccgcttttaaacggc
gcttctttatatgtaagtgaccaggaaacctatctcgactctgatgttctggaaacattt
atacaacaaaacggcattacgacactgtggctgacatcgtctctgttcaaccatttatca
gaacaaaatgaacacgtgttttccggattatcccgattgattatcggcggggaagcactg
tccccaagccatgtaaaccgggttcggaatgcgctgccgcatctctcagtatggaatgga
tacggaccgactgaaaacacgacgttctcgacttgctttttgattgaacaatcatacgat
cattcaatcccgatcgggcgccctgtcggaaattcaaccgcatatatcataaacagcagg
ggaacaccgcagccgatcggcgtcatcggcgaattgtgcacgggcggagacggtgtggca
agaggatatttcggccgccctgagctgacggaagaaaaatttgtccccaatccttttgtt
cccggagaacggatgtaccgcaccggagatttagcccgctggctgccggacggaacgatc
gaatatgccgggcggatggatgatcaagtgaaaatccgcggttatcgggtcgagctggga
gagattgaagcaacactgaggagcctggacggcgtgaaagaagctgtcgtgtcagtcaga
accgggcagtccggcaataaagaactgatcgcatatatgagtctgcaggcggacatggat
acagaaaaagtgcgttcttcactgtctaagcaactgccgaattacatggttccggcctat
atgatggaacttgagaagctgccgcttacgccgaacggtaaattggatcggaaaaatctg
cccgaaccggagctcgcgcttcaaaccgcgtacacagctccccgcaatgagcttgaagaa
cagctttccgtgatctggcaggaagtgctcggcacaaaacaagtcgggattgaggactca
ttttttgagttgggcggcgattcaatcaaagcgctgcaagtttccgcacggctcggacgc
tatgggcggaaaatgacggcaagcgacttattccggcatccgtccattaaggagctcgcg
ccacttatccggaaagcggaaagagtcatcgatcagcggcaggtggaaggagacatacct
tggacacccgttcagcactggtttttatcacagcggatggaaaacagaaatcatttcaat
cagtccgtcatgatgttcagctctgacgcattgcataaacagccgctcaaagaagccttg
gagcatcttgtcattcatcatgatgcactccggatcaccgtcagtgcagaaaacgaaagt
ttcagacaaatcaatcacggtattcaaaaagatgaactgtacagcttggacatttgggat
ctgtctgagacagatacttgggaaaaagaaatagaaagtgaagtcgctgcgctccaacag
cggatggatattgaaaaaggcccgttattaaaagccggctggttcaaaacccggtccggg
gattatttattcatcaccgtacatcacctggcggttgacggagtgtcatggcgtattttg
ctggaggatttatctgccgcttacactcaagccgtaaaaggtcagccggtccagcttccg
ccaaagaccgattcgtttaagcaatacgctgaaaggctttcagaatacgcaaaaagcagc
aagctgatgcgtgaagaagaatattggcgttttattgaagaagaaacagccgccgaactt
ccttatgaaaaaccgcagcatcagacgggagccgacagcattcggcaaacggtaagcttt
acgcttacagaagaagaaacgtccgttttgcttcagcaggtcaaccgggcctaccatacc
gatacgcaagatattcttctgactgccgcagctttggctttacgggactggacagggggc
ggcagactgcgcatcgcgatggaagggcacgggagagagcacatcatgccggagctcgac
atcagccgcaccgtaggctggtttacctccatgtatccggtgctcattgacttgaacaca
gcaggcgctgagcttggaacggcggtaaaaacggtcaaagacacactcggaagaataccg
gataaaggaataggctacggcattttaaaatacatgacaccgcctgaacaaaaaacaatc
cgcttcagacaagcgcctgaaatcagctttaactatttagggcaattcaatgatacagaa
gatcagcacacgttcagtctgtccggtcttgcaagcgggcacgacatcacgccgacatgg
cagcgggaacaagcggtggaaatgagcgcgatggccgcacaaaacaaacttcacttcagt
ttgagctatccgccgagccgcttccgcaaagaaacgatggaacagctgctgcaaacttta
cagcaatatttgcgtgatattatggcgcactgcaccggcaaagaggaagcagaaaaaacc
gttagtgattttagcagcaaaacgttaacatctgatgatttggacagcatagcgagtttt
gtcgaggaactgtag

DBGET integrated database retrieval system