KEGG   Bacillus velezensis NAU-B3: BAPNAU_1900
Entry
BAPNAU_1900       CDS       T02859                                 
Symbol
fenC
Name
(GenBank) non-ribosomal peptide synthetase FenC involved in fengycin synthesis
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BAPNAU_1900 (fenC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bamb01008]
    BAPNAU_1900 (fenC)
Polyketide biosynthesis proteins [BR:bamb01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    BAPNAU_1900 (fenC)
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: CDH95681
LinkDB
Position
1969129..1976778
AA seq 2549 aa
MGQQPEIQDIYPLSFMQEGMLFHSLLDHDSRAYFEQAVFTINGQLDRGRFQKSIDAVFER
YDIFRTTFIHKNVAKPRQVVLKNRPSRVQFHDISHLDEKAQDKYADRFRKEDKDKGFDLQ
SDPLMRVSILKKAPERYVCIWSHHHIVMDGWCFGIVMKEFLMIYQSLGDGRLPSLEPVQP
YGKYIKWLMKQDRKEAEIFWKTRLADLEQSASLPKKSAEPNGELEQAVFTISEEQTNELK
NIAARAGATLNTVFQALWGILLQRVSRCDDAVFGSVVSGRPSDLAGVEKMVGLFINTIPV
RVKSGSFSFLELVRHLQQETLQAEAYSYYPLYDIQAQSPLKQALFDHIIVFENVPAQREI
ENVSQAGSFDFAVEDFTMEEVTNYGCSIKVIPGSSLYIRLNFDTGIYDRVFMKNIETFLR
HMMKSVISDPEMSASEIALLDACEARNMLDAFNRTETVEPPAPTLHGLFTRRAALSPHRP
ALRFPGGMLTYAELDQYTDRLAVWLRQKGVRKESMVGVLAERSPEMVVSVLAVLKAGGAY
VPLDPDYPEDRLRYMLEDCGACLLLAQPGLSVSGFSGETLEVSLSALTGETETGAVSEEA
DADSLAYIIYTSGSTGTPKGVAVEHRQAAAFLSGMQGQFPLTEEDIIVMKSSFSFDASIW
QLFWWTMSGASVYLLPAGWEKDPVRMIEVFSSEKVTTAHFIPAMVNSFLDALETEPEETR
TRLGRTLTRVFAGGEALSPLTAARFADLLPETVLIHGYGPTEATVDAAFYVCDRKRDSGR
TRLPIGKPVPGARLYVLDSGGTIQPAGVAGELYIAGTGVARGYLNRPELTEERFLDDPFY
PGERMYQTGDIARWTEDGLVEWLGRSDGQVKVRGYRIEPGEIEAAIRRIDGIREAAVTAR
TEHGETALYAYIEGRESDDVRAELAARLPAYMMPAQFIEMSEWPVTPSGKLDRRALPAPD
GAADRRVYTAPRNVTEMKLCALWEEVLKNGPVGIRDHFFERGGHSLKATALVSRIAKEFG
VQVPLQDIFARPTVEELALVIQDLEESPYEAIQPAKTQDTYPVSSAQKRMYVLQQLEDGG
IGYNMPAVLELTGPLDRGRLEETFRQLVERHESLRTSFETGPDGEPVQRIHDSVPFQLDE
AESADAFVRPFCLEEAPLFRAALVKESDERHLLLTDMHHIISDGVSVNTLIKEFGELYAG
RSLAPMRLQYKDYAVWQRSFQEKEGYQKQEAYWLKRLEGELPVLELPADKPRPAVRSFAG
GSVSCTLDAETASGLHRIARDHGSTLYMVLLAAYNTLLARLSGQEDIIVGSPIAGRPHKD
LEPILGMFVNTLAIRTEPKGDKRFTDYLAEVRQAALEAYEHQDYPFEELVERLGVQRDTS
RNPLFDVMFVLQNMERESLVLNKLHLTQAADTSHKTAKFDATLYASEGSDGSISFDFEFN
TDIYQKQTIEKWLSYFTRILTKVIENQAIPLGDIHVLDDAETNRVIYQFNQTKSDYPRHE
TISRLFERQAKETPDARAVVYDGQILTYRELNERANRIAAALRSNGVGPESVVALLTGRT
TELASGILGILKAGGAYLPIGDDVPRERAEWMLKDCKADILLQSDKLDGLPLSGKRLFIE
DIQTKAGLSSENPEPLGGPESLAYMIYTSGSTGAPKGVMIEQRSVIRLVKNSNYIDFTPK
DRLLFTSSLGFDVTTFEIFGPLLNGASLYVSDQETYLDSDVLETFIQQNGITTLWLTSSL
FNHLSEQNKDVFSGLSRLIIGGEALSPSHVNRVRNALPHLSVWNGYGPTENTTFSTCFLI
EQSYDHSIPIGRPVGNSTAYIINSRGTPQPIGVIGELCTGGDGVARGYFGRPELTQEKFV
PNPFVPGERMYRTGDLARWLPDGTIEYAGRMDDQVKIRGYRVELGEIEAALRSLDGVKEA
AVSVRTGQSGNKELIAYMSLQADMDTEKVRSSLSKQLPNYMVPAYMMELEKLPLTPNGKL
DRKNLPEPELTLQTAYTAPRNELEEQLSVIWQEVLGTKQVGIEDSFFELGGDSIKALQVS
ARLGRYGWKMTASDLFRHPSIKELAPLIRKAERVIDQRPVEGDIPWTPVQHWFLSQRMEN
RNHFNQSVMMFSSDALQKQPLKEALEHLVIHHDALRITVSEENESIRQINHGIQKAELYT
LDIWDMSETDTWEREIETEVAALQQRMDIEKGPLLKAGWFKTRSGDYLFITVHHLAVDGV
SWRILLEDLSAAYTQAVKGQPVQLPPKTDSFKQYAERLSEYAKSSKLMREEEYWRFIEEE
TAAELPYEKPQHQTGADSIRQTVSFTLTEEETSVLLQQVNRAYHTDTQDILLTAAALALR
DWTGGGRLRIAMEGHGREHIMPELDISRTVGWFTSMYPVLIDLNTAGSELGTAVKTVKDT
LGRIPDKGIGYGILKYMTPPEQKTIRFRQAPEISFNYLGQFNDTEDQHTFSLSGLASGHD
ITPTWQREQAVEMSAMAAQHKLHFSLSYPPSRFSKETMEQLLQTLQQYLRDIMAHCTGKE
EAEKTVSDFSSKTLTSDDLDSIASFVEEL
NT seq 7650 nt   +upstreamnt  +downstreamnt
atggggcagcaaccggaaatacaagatatatatcctttatcttttatgcaggagggcatg
ctttttcattctctgttggatcatgactcaagagcctacttcgaacaagcggtgtttacg
atcaacggacagcttgaccggggacgattccaaaaaagtatagatgctgtttttgaacga
tacgatattttccgtacgacatttattcataagaatgtggcgaagccccgccaagtcgtg
ttgaaaaacaggccgagccgcgttcaatttcatgatatttctcatttggacgagaaggca
caagacaaatatgccgaccggttcagaaaagaagataaagataaaggctttgatttgcaa
tcagaccctctcatgagagtctccattttgaaaaaagcgcccgaacgctatgtttgtata
tggagccatcatcatatcgtcatggacggctggtgcttcggaattgtcatgaaggaattt
ctgatgatctatcaatctctcggagacggacggcttccgtctctcgagcctgttcagcca
tatggaaagtatattaaatggctcatgaagcaggatcgtaaagaagccgagattttttgg
aaaacgagacttgccgatcttgagcaatcggcgtctcttccgaaaaaatccgcggaacca
aatggcgaacttgagcaggcggttttcaccatttctgaagagcagacaaatgagctgaag
aacattgcggcaagggcgggagcaacgctgaatacagtgttccaggcactgtggggcatt
ttgctgcagcgtgtcagccgctgtgatgacgccgttttcggttctgtcgtttccggccgg
ccgtcggatctcgcaggcgtggaaaaaatggtgggactgtttattaatacgattcccgtg
cgggtgaaaagcggttcattttcttttctggagctcgtcaggcatttgcagcaggagacg
ctgcaagcagaagcgtacagctattatccgctgtatgacattcaggcgcaaagccctttg
aagcaagcgctgtttgaccacattatcgtgtttgaaaatgtgccggcccagcgtgaaatt
gaaaatgtgagtcaggccggttcatttgattttgcggtagaagatttcacgatggaggaa
gtcacaaactacggatgcagcataaaggtgattccgggaagttctctttatatccgctta
aactttgatacgggtatatacgatcgtgtttttatgaagaatattgaaacatttttacgg
catatgatgaagtcagtcatttccgaccctgaaatgagcgcctccgagatcgcattgctg
gatgcgtgtgaagccagaaatatgctggatgcgtttaaccgtacagaaacggttgaaccg
ccggccccgacgcttcacggactgtttacccgccgcgccgcgctttcgccgcatcgtccg
gcgctccgttttccgggcggcatgctgacgtacgctgagctcgaccagtacacagacagg
ctcgccgtttggctccgccaaaagggcgtccgcaaagaaagcatggtcggcgtactcgct
gaacgctcgccggagatggtggtttcagtgcttgccgtgttaaaagcgggcggcgcctac
gtgccgcttgaccctgactatcctgaggacaggctgcgctatatgctcgaggactgcggc
gcctgcctcctgcttgcacagccgggattatccgtttccggtttttccggagaaacgcta
gaagtatctctttctgctctgacaggcgagacggagacaggggctgtctctgaagaagcg
gatgccgattcgctcgcttatatcatttatacgtccggttcgacgggaacaccgaaggga
gtggctgttgaacaccgtcaggccgccgcctttttatcagggatgcaagggcagtttccg
ttaacggaagaggatattatcgttatgaaatcatccttttcattcgacgcctccatctgg
caattgttttggtggacgatgtccggcgcctccgtgtatctgcttcctgccgggtgggag
aaagatcctgtgcggatgattgaagttttttcttctgaaaaggtgacgaccgcgcatttt
attccggcgatggtcaacagctttttagacgcgctggaaacggagcctgaggaaacaaga
acacgcctcggcagaacactgacacgcgtgtttgccggaggggaagctctttccccgctt
acggctgcccggtttgccgatcttctgccagagaccgtgcttattcacggctacgggccg
acagaagcgacggttgatgcggcgttttacgtctgtgaccgaaaacgggacagcggacgg
acaaggcttccgattggtaaacccgttcctggtgcccgtctgtatgtattagatagcgga
ggaaccatccagcctgcgggcgtggcaggagagttgtacatcgcggggacaggggtggcc
cggggctatctgaaccggcctgagctgacggaggagcgttttctcgatgatccgttttat
ccgggagagcgcatgtatcaaacgggcgatatcgcacgctggacagaagacggccttgtc
gaatggctcggccgttcagacggacaggtgaaagtccgcggctaccggatcgaaccgggg
gagattgaagcggcgatccggcgcatcgacggcattcgtgaggcggcggtcaccgcccgg
accgaacacggcgaaaccgcgctttacgcctatatcgaaggacgggaaagcgacgacgtg
cgggcggagcttgcggcacgccttccggcctacatgatgccggctcagtttatagagatg
agcgaatggccggtcacgccgagcggaaaacttgaccgccgcgcgctgccggctcccgac
ggagcggcagacagacgggtgtacaccgccccgcggaacgtcacggaaatgaagctttgc
gccctttgggaagaggtgctgaaaaacggccccgtcggcatccgggatcacttttttgag
cggggcggccattcgttaaaagcgacggctctcgtctcccgcatcgccaaagagttcggt
gttcaggtgccgttacaggacatcttcgcccgtccgacggtggaagagctcgctttggtt
attcaggacttggaagaaagcccgtatgaagcgattcagcctgcgaaaacacaagatacc
tatccggtgtcttcggcgcagaaacggatgtatgtgctccaacagcttgaagacggcggt
atcggctacaatatgccggctgtgctggaactgacgggcccgcttgaccgcggccggctg
gaggagacgttccggcagcttgtggagcggcatgagtcgctcagaacgtcctttgaaacg
gggcctgacggcgaaccggtgcagcgcatccatgacagcgtgccgtttcagctcgatgag
gccgagtcagctgacgcattcgtccggccgttttgtctggaggaagcgccgctcttccgt
gcggccctcgtgaaagaatcagacgaacgtcatcttttattaacggatatgcatcatatt
atttctgacggtgtgtccgtcaacaccttgattaaagaattcggcgagctgtacgcaggc
cgttcgcttgcgccgatgcgccttcaatataaagactatgccgtctggcagcggtcgttt
caggagaaagaaggatatcagaagcaggaagcgtattggctgaagcggctagaaggagag
cttccggtgcttgagcttccggctgacaagccccgtccggctgtcagaagctttgcgggc
ggcagcgtatcgtgcacgcttgacgctgaaaccgcatccggccttcaccgcatcgcccgg
gatcacggctccactttgtatatggtgcttctcgccgcgtacaatacgttactcgcgcga
ttgagcgggcaggaagacatcatcgtcggctcgccgattgccgggcgcccgcacaaagac
ctcgaaccgattctcggcatgttcgtcaacacgctggccatcagaacggagccgaaagga
gacaaacggtttaccgattatttggcggaagtccgccaggcggcgcttgaagcgtatgag
catcaggattacccgtttgaagagcttgtggagcggctcggcgtgcagcgggacacaagc
cgcaatccgctgtttgatgtgatgtttgtgcttcaaaatatggagcgtgaatccctggtg
ttaaataagctgcatttgactcaagctgcggatacaagtcataaaaccgcaaagtttgat
gccacgctttacgcgtcagaagggtctgacggttccatcagctttgattttgaattcaat
acagatatctatcaaaaacagacaattgaaaaatggctttcttattttacccgtattctt
acaaaagtaattgaaaaccaagcgataccgcttggtgacattcacgtactggatgatgct
gaaacaaatcgcgtcatttatcagtttaatcagacgaaaagcgattacccaagacacgaa
accatcagccgtttatttgagcggcaggcaaaagaaacccccgatgcccgggcagttgta
tatgatggacaaatcttgacataccgtgagctgaacgaacgggctaacagaatagcggcg
gctctccgatcaaatggcgtcggtccggaaagcgttgtcgccttattaaccggccgcaca
acagagcttgcttccggaatcctcggaatattaaaagcgggaggcgcctacttgcctatc
ggtgacgatgtgccgcgggaacgggctgaatggatgcttaaagactgtaaagctgatatt
cttctccaatctgataaacttgacggtctgccgctttcaggaaaacgtttattcatagag
gatattcaaacaaaggccggcttgagttcggaaaatcccgaaccgctcggcggacctgaa
tcgttggcctacatgatttatacgtccgggtcaacaggtgcgccaaaaggcgtcatgatt
gaacagcgaagcgtgatccgccttgtgaaaaacagcaattatattgattttacgccgaaa
gacagactgttgtttacttcatcattaggatttgacgttacgacatttgaaatattcggt
ccgcttttaaacggcgcttctttatatgtaagtgaccaggaaacctatctcgactctgat
gttctggaaacatttatacagcaaaacggcattacgacactgtggctgacatcgtctctg
ttcaaccatttatcagaacaaaataaagacgtgttttccggattatcccgattgattatc
ggcggggaagcactgtccccgagccatgtaaaccgggttcggaatgcgctgccgcatctc
tcagtatggaatggatacggaccgactgaaaacacgacgttctcgacttgctttttgatt
gaacaatcatacgatcattcaatcccgatcggccgccctgtcggaaattcaaccgcatat
atcataaacagcaggggaacaccgcagccgatcggcgtcatcggcgaattgtgcacgggg
ggagacggtgtggcaagaggatatttcggccgccctgagctgacgcaagaaaaatttgtc
cctaatccttttgttcccggagaacggatgtaccgcaccggagatttagcccgctggctg
ccggacggaacgatcgaatatgccgggcggatggatgatcaagtgaaaatccgcggttat
cgggtcgagctgggagagattgaagccgcactgaggagcctggacggtgtgaaagaagct
gccgtgtcagtcagaaccgggcagtccggcaataaagaactgatcgcatatatgagtctg
caggcggacatggatacagaaaaagtgcgttcttcattgtctaagcaactgccgaattac
atggttccggcctatatgatggaacttgagaagctgccgcttacgccgaacggtaaattg
gatcggaaaaatcttcccgaaccggagcttacgcttcaaaccgcgtacacagctccccgc
aatgagcttgaagaacagctttccgtgatctggcaggaagtgctcggcacaaaacaagtc
gggattgaggactcattttttgagttgggcggcgattcaatcaaagcgctgcaagtttcc
gcacggctcggacgctatgggtggaaaatgacggcaagtgacttattccggcacccgtcc
attaaggaactcgcgcctcttatccggaaagcggaaagagtcatcgatcagcggccggtg
gaaggagacataccttggacacccgttcagcactggtttttatcacagcggatggaaaac
agaaatcatttcaatcagtccgtcatgatgttcagctctgacgcattgcaaaaacagccg
ctcaaagaagccttggagcatcttgtcattcatcatgatgcactccggatcaccgtcagt
gaagaaaacgaaagtatcagacaaatcaatcacggtattcaaaaagctgagctgtacacc
ttggacatttgggatatgtctgagacagatacttgggaaagagaaatagaaactgaagtg
gctgcgctccaacagcggatggatattgaaaaagggccgttattaaaagccggctggttc
aaaacccggtccggggattatttattcatcaccgtacatcacctggcggttgacggagtg
tcatggcgtattctgctggaggatttatctgccgcttacactcaagctgtaaaaggtcag
ccggtccagcttccgccaaagaccgattcgtttaagcaatacgctgaaaggctttcggaa
tacgcaaaaagcagcaagctgatgcgtgaagaagaatattggcgttttattgaagaagaa
acagccgccgaacttccttatgaaaaaccgcagcatcagacgggagccgacagcattcgg
caaacggtaagctttacgcttacagaagaagaaacgtccgttttgcttcagcaggtcaac
cgggcctaccataccgatacgcaagatattcttctgaccgccgcagctttggctttacgg
gactggacagggggcggcagactgcgcatcgcgatggaagggcacgggagagagcacatc
atgccggagctcgacatcagccgcaccgtaggctggtttacctccatgtatccggtgctc
attgacttgaatacagcaggctcagaacttgggacggcggtaaaaacggtcaaagacaca
ctcggaagaataccggataaaggaataggctacggcattttaaaatacatgacaccgcct
gaacaaaaaacaatccgcttcagacaagcgcctgaaatcagctttaactatttagggcaa
ttcaacgatacagaagatcagcacacgttcagcctgtccggtctggcaagcgggcacgac
atcacgccgacgtggcagcgggaacaagcggtggaaatgagcgcgatggccgcacaacat
aaacttcacttcagtttgagctatccgccgagccgcttctccaaagaaacgatggaacag
ctgctgcaaaccttacagcaatatttgcgtgatattatggcgcactgcacagggaaagag
gaagcagaaaaaaccgttagtgattttagcagcaaaacgttaacatctgatgatttggac
agcatagcgagttttgtcgaggaactgtag

DBGET integrated database retrieval system